Recombinant Human NAGLU protein, His-tagged
| Cat.No. : | NAGLU-705H |
| Product Overview : | Recombinant Human NAGLU protein(NP_000254)(394-743 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 394-743 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | TASFQGQPFIWCMLHNFGGNHGLFGALEAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAARRYGVSHPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAWRLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAYELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGSW |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NAGLU N-acetylglucosaminidase, alpha [ Homo sapiens ] |
| Official Symbol | NAGLU |
| Synonyms | NAGLU; N-acetylglucosaminidase, alpha; alpha-N-acetylglucosaminidase; NAG; Sanfilippo disease IIIB; N-acetyl-alpha-glucosaminidase; MPS3B; UFHSD; MPS-IIIB; |
| Gene ID | 4669 |
| mRNA Refseq | NM_000263 |
| Protein Refseq | NP_000254 |
| MIM | 609701 |
| UniProt ID | P54802 |
| ◆ Recombinant Proteins | ||
| NAGLU-3217M | Recombinant Mouse NAGLU protein, His-tagged | +Inquiry |
| NAGLU-705H | Recombinant Human NAGLU protein, His-tagged | +Inquiry |
| NAGLU-7905H | Recombinant Human NAGLU protein, His & T7-tagged | +Inquiry |
| Naglu-7906M | Recombinant Mouse Naglu protein, His & GST-tagged | +Inquiry |
| NAGLU-27921TH | Recombinant Human NAGLU | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAGLU Products
Required fields are marked with *
My Review for All NAGLU Products
Required fields are marked with *
