Recombinant Human NAMPT protein, His-tagged

• Cat.No.: NAMPT-2414H
• Product Overview: Recombinant Human NAMPT protein(163-360 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 163-360 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: TNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NAMPT nicotinamide phosphoribosyltransferase [ Homo sapiens ]
• Official Symbol: NAMPT
• Synonyms: NAMPT; nicotinamide phosphoribosyltransferase; PBEF1, pre B cell colony enhancing factor 1; PBEF; visfatin; NAmPRTase; pre-B cell-enhancing factor; pre-B-cell colony enhancing factor 1; pre-B-cell colony-enhancing factor 1; VF; PBEF1; VISFATIN; 1110035O14Rik; MGC117256; DKFZp666B131
• Gene ID: 10135
• mRNA Refseq: NM_005746
• Protein Refseq: NP_005737
• MIM: 608764
• UniProt ID: P43490