Recombinant Human NAMPT protein, His-tagged
| Cat.No. : | NAMPT-2473H |
| Product Overview : | Recombinant Human NAMPT protein(1-350 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-350 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKGWNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NAMPT nicotinamide phosphoribosyltransferase [ Homo sapiens ] |
| Official Symbol | NAMPT |
| Synonyms | NAMPT; nicotinamide phosphoribosyltransferase; PBEF1, pre B cell colony enhancing factor 1; PBEF; visfatin; NAmPRTase; pre-B cell-enhancing factor; pre-B-cell colony enhancing factor 1; pre-B-cell colony-enhancing factor 1; VF; PBEF1; VISFATIN; 1110035O14Rik; MGC117256; DKFZp666B131; |
| Gene ID | 10135 |
| mRNA Refseq | NM_005746 |
| Protein Refseq | NP_005737 |
| MIM | 608764 |
| UniProt ID | P43490 |
| ◆ Recombinant Proteins | ||
| NAMPT-3579H | Recombinant Human NAMPT Protein, His (Fc)-Avi-tagged | +Inquiry |
| NAMPT-2429C | Recombinant Chicken NAMPT | +Inquiry |
| NAMPT-3233P | Recombinant Pig NAMPT protein, His-tagged | +Inquiry |
| Nampt-157M | Recombinant Mouse Pre-B-cell Colony-enhancing Factor 1, His-tagged | +Inquiry |
| NAMPT-2531H | Recombinant Human NAMPT protein(Met1-His491), His&GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAMPT-491HCL | Recombinant Human NAMPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAMPT Products
Required fields are marked with *
My Review for All NAMPT Products
Required fields are marked with *
