Recombinant Human NANP, His-tagged
Cat.No. : | NANP-28781TH |
Product Overview : | Recombinant full length Human NANP with an N terminal His tag; 284 amino acids with tag, MWt 31.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 248 amino acids |
Description : | NANP (N-acylneuraminate-9-phosphatase), also known as HDHD4 (Haloacid dehalogenase-like hydrolase domain-containing protein 4), is belongs to the haloacid dehalogenase (HAD) family and is responsible for dephosphorylating N-acylneuraminate 9-phosphate to |
Conjugation : | HIS |
Molecular Weight : | 31.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST |
Gene Name | NANP N-acetylneuraminic acid phosphatase [ Homo sapiens ] |
Official Symbol | NANP |
Synonyms | NANP; N-acetylneuraminic acid phosphatase; C20orf147, chromosome 20 open reading frame 147 , haloacid dehalogenase like hydrolase domain containing 4 , HDHD4; N-acylneuraminate-9-phosphatase; dJ694B14.3; MGC26833; |
Gene ID | 140838 |
mRNA Refseq | NM_152667 |
Protein Refseq | NP_689880 |
MIM | 610763 |
Uniprot ID | Q8TBE9 |
Chromosome Location | 20p11.1 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), conserved biosystem; Metabolic pathways, organism-specific biosystem; superpathway of sialic acid and CMP-sialic acid biosynthesis, conserved biosystem; |
Function | N-acylneuraminate-9-phosphatase activity; hydrolase activity; phosphoglycolate phosphatase activity; |
◆ Recombinant Proteins | ||
NANP-2739C | Recombinant Chicken NANP | +Inquiry |
Nanp-1813M | Recombinant Mouse Nanp Protein, His-tagged | +Inquiry |
NANP-3555R | Recombinant Rat NANP Protein, His (Fc)-Avi-tagged | +Inquiry |
NANP-2943R | Recombinant Rhesus monkey NANP Protein, His-tagged | +Inquiry |
NANP-28781TH | Recombinant Human NANP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NANP-3980HCL | Recombinant Human NANP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NANP Products
Required fields are marked with *
My Review for All NANP Products
Required fields are marked with *
0
Inquiry Basket