Recombinant Human NANP, His-tagged

Cat.No. : NANP-28781TH
Product Overview : Recombinant full length Human NANP with an N terminal His tag; 284 amino acids with tag, MWt 31.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 248 amino acids
Description : NANP (N-acylneuraminate-9-phosphatase), also known as HDHD4 (Haloacid dehalogenase-like hydrolase domain-containing protein 4), is belongs to the haloacid dehalogenase (HAD) family and is responsible for dephosphorylating N-acylneuraminate 9-phosphate to
Conjugation : HIS
Molecular Weight : 31.900kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST
Gene Name NANP N-acetylneuraminic acid phosphatase [ Homo sapiens ]
Official Symbol NANP
Synonyms NANP; N-acetylneuraminic acid phosphatase; C20orf147, chromosome 20 open reading frame 147 , haloacid dehalogenase like hydrolase domain containing 4 , HDHD4; N-acylneuraminate-9-phosphatase; dJ694B14.3; MGC26833;
Gene ID 140838
mRNA Refseq NM_152667
Protein Refseq NP_689880
MIM 610763
Uniprot ID Q8TBE9
Chromosome Location 20p11.1
Pathway Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), conserved biosystem; Metabolic pathways, organism-specific biosystem; superpathway of sialic acid and CMP-sialic acid biosynthesis, conserved biosystem;
Function N-acylneuraminate-9-phosphatase activity; hydrolase activity; phosphoglycolate phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NANP Products

Required fields are marked with *

My Review for All NANP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon