Recombinant Human NANP, His-tagged

• Cat.No.: NANP-28781TH
• Product Overview: Recombinant full length Human NANP with an N terminal His tag; 284 amino acids with tag, MWt 31.9 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 248 amino acids
• Description: NANP (N-acylneuraminate-9-phosphatase), also known as HDHD4 (Haloacid dehalogenase-like hydrolase domain-containing protein 4), is belongs to the haloacid dehalogenase (HAD) family and is responsible for dephosphorylating N-acylneuraminate 9-phosphate to
• Conjugation: HIS
• Molecular Weight: 31.900kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST

Gene Information

• Gene Name: NANP N-acetylneuraminic acid phosphatase [ Homo sapiens ]
• Official Symbol: NANP
• Synonyms: NANP; N-acetylneuraminic acid phosphatase; C20orf147, chromosome 20 open reading frame 147 , haloacid dehalogenase like hydrolase domain containing 4 , HDHD4; N-acylneuraminate-9-phosphatase; dJ694B14.3; MGC26833
• Gene ID: 140838
• mRNA Refseq: NM_152667
• Protein Refseq: NP_689880
• MIM: 610763
• Uniprot ID: Q8TBE9
• Chromosome Location: 20p11.1
• Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; CMP-N-acetylneuraminate biosynthesis I (eukaryotes), conserved biosystem; Metabolic pathways, organism-specific biosystem; superpathway of sialic acid and CMP-sialic acid biosynthesis, conserved biosystem
• Function: N-acylneuraminate-9-phosphatase activity; hydrolase activity; phosphoglycolate phosphatase activity