Recombinant Human NAP1L1 protein, His-tagged
Cat.No. : | NAP1L1-4714H |
Product Overview : | Recombinant Human NAP1L1 protein(P55209)(2-388 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-388 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 45.8 kDa |
AASequence : | ADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAEC |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | NAP1L1 nucleosome assembly protein 1-like 1 [ Homo sapiens ] |
Official Symbol | NAP1L1 |
Synonyms | NAP1L1; nucleosome assembly protein 1-like 1; MGC8688; MGC23410; NAP1; NAP1L; NRP; hNRP; NAP-1 related protein; NAP-1-related protein; HSP22-like protein interacting protein; FLJ16112; |
Gene ID | 4673 |
mRNA Refseq | NM_004537 |
Protein Refseq | NP_004528 |
MIM | 164060 |
UniProt ID | P55209 |
◆ Recombinant Proteins | ||
NAP1L1-30313TH | Recombinant Human NAP1L1, His-tagged | +Inquiry |
NAP1L1-11465Z | Recombinant Zebrafish NAP1L1 | +Inquiry |
NAP1L1-791H | Recombinant Human NAP1L1 Protein, His-tagged | +Inquiry |
NAP1L1-1386HFL | Recombinant Full Length Human NAP1L1 Protein, C-Flag-tagged | +Inquiry |
NAP1L1-5675H | Recombinant Human NAP1L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAP1L1-3978HCL | Recombinant Human NAP1L1 293 Cell Lysate | +Inquiry |
NAP1L1-3977HCL | Recombinant Human NAP1L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAP1L1 Products
Required fields are marked with *
My Review for All NAP1L1 Products
Required fields are marked with *