Recombinant Human NAP1L1 protein, His-tagged

Cat.No. : NAP1L1-4714H
Product Overview : Recombinant Human NAP1L1 protein(P55209)(2-388 aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 2-388 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 45.8 kDa
AASequence : ADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAEC
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name NAP1L1 nucleosome assembly protein 1-like 1 [ Homo sapiens ]
Official Symbol NAP1L1
Synonyms NAP1L1; nucleosome assembly protein 1-like 1; MGC8688; MGC23410; NAP1; NAP1L; NRP; hNRP; NAP-1 related protein; NAP-1-related protein; HSP22-like protein interacting protein; FLJ16112;
Gene ID 4673
mRNA Refseq NM_004537
Protein Refseq NP_004528
MIM 164060
UniProt ID P55209

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NAP1L1 Products

Required fields are marked with *

My Review for All NAP1L1 Products

Required fields are marked with *

0
cart-icon
0
compare icon