Recombinant Human NAP1L1 protein, His-tagged
| Cat.No. : | NAP1L1-4714H |
| Product Overview : | Recombinant Human NAP1L1 protein(P55209)(2-388 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-388 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 45.8 kDa |
| AASequence : | ADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAEC |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | NAP1L1 nucleosome assembly protein 1-like 1 [ Homo sapiens ] |
| Official Symbol | NAP1L1 |
| Synonyms | NAP1L1; nucleosome assembly protein 1-like 1; MGC8688; MGC23410; NAP1; NAP1L; NRP; hNRP; NAP-1 related protein; NAP-1-related protein; HSP22-like protein interacting protein; FLJ16112; |
| Gene ID | 4673 |
| mRNA Refseq | NM_004537 |
| Protein Refseq | NP_004528 |
| MIM | 164060 |
| UniProt ID | P55209 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAP1L1 Products
Required fields are marked with *
My Review for All NAP1L1 Products
Required fields are marked with *




