Recombinant Human NAP1L1 protein, His-tagged

• Cat.No.: NAP1L1-4714H
• Product Overview: Recombinant Human NAP1L1 protein(P55209)(2-388 aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 2-388 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 45.8 kDa
• AASequence: ADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAEC
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: NAP1L1 nucleosome assembly protein 1-like 1 [ Homo sapiens ]
• Official Symbol: NAP1L1
• Synonyms: NAP1L1; nucleosome assembly protein 1-like 1; MGC8688; MGC23410; NAP1; NAP1L; NRP; hNRP; NAP-1 related protein; NAP-1-related protein; HSP22-like protein interacting protein; FLJ16112
• Gene ID: 4673
• mRNA Refseq: NM_004537
• Protein Refseq: NP_004528
• MIM: 164060
• UniProt ID: P55209