Recombinant Human NAP1L4, His-tagged
Cat.No. : | NAP1L4-29718TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 24-375 of Human NAP1L4 with an N terminal His tag. Predicted mwt: 42 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-375 a.a. |
Description : | This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 95 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | TEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAV KRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQP LFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKV VVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQE YDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFT NSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKG KNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNP LKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINP KV |
Gene Name | NAP1L4 nucleosome assembly protein 1-like 4 [ Homo sapiens ] |
Official Symbol | NAP1L4 |
Synonyms | NAP1L4; nucleosome assembly protein 1-like 4; NAP2; |
Gene ID | 4676 |
mRNA Refseq | NM_005969 |
Protein Refseq | NP_005960 |
MIM | 601651 |
Uniprot ID | Q99733 |
Chromosome Location | 11p15.5 |
Function | unfolded protein binding; |
◆ Recombinant Proteins | ||
NAP1L4-3898R | Recombinant Rat NAP1L4 Protein | +Inquiry |
NAP1L4-1857H | Recombinant Human NAP1L4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NAP1L4-3557R | Recombinant Rat NAP1L4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAP1L4-2317H | Recombinant Human NAP1L4, His-tagged | +Inquiry |
NAP1L4-1608C | Recombinant Chicken NAP1L4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAP1L4-3974HCL | Recombinant Human NAP1L4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAP1L4 Products
Required fields are marked with *
My Review for All NAP1L4 Products
Required fields are marked with *