Recombinant Human NAP1L4 protein, His-tagged
| Cat.No. : | NAP1L4-3511H |
| Product Overview : | Recombinant Human NAP1L4 protein(222 - 375 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | June 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 222 - 375 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | TKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NAP1L4 nucleosome assembly protein 1-like 4 [ Homo sapiens ] |
| Official Symbol | NAP1L4 |
| Synonyms | NAP1L4; nucleosome assembly protein 1-like 4; NAP2; NAP-2; nucleosome assembly protein 2; nucleosome assembly protein 1-like 4b; NAP2L; hNAP2; NAP1L4b; MGC4565; |
| Gene ID | 4676 |
| mRNA Refseq | NM_005969 |
| Protein Refseq | NP_005960 |
| MIM | 601651 |
| UniProt ID | Q99733 |
| ◆ Recombinant Proteins | ||
| NAP1L4-3898R | Recombinant Rat NAP1L4 Protein | +Inquiry |
| NAP1L4-1857H | Recombinant Human NAP1L4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NAP1L4-2317H | Recombinant Human NAP1L4, His-tagged | +Inquiry |
| NAP1L4-301244H | Recombinant Human NAP1L4 protein, GST-tagged | +Inquiry |
| NAP1L4-1608C | Recombinant Chicken NAP1L4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAP1L4-3974HCL | Recombinant Human NAP1L4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAP1L4 Products
Required fields are marked with *
My Review for All NAP1L4 Products
Required fields are marked with *
