Recombinant Human NAP1L4 protein, His-tagged
Cat.No. : | NAP1L4-3511H |
Product Overview : | Recombinant Human NAP1L4 protein(1-375 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-375 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NAP1L4 nucleosome assembly protein 1-like 4 [ Homo sapiens ] |
Official Symbol | NAP1L4 |
Synonyms | NAP1L4; nucleosome assembly protein 1-like 4; NAP2; NAP-2; nucleosome assembly protein 2; nucleosome assembly protein 1-like 4b; NAP2L; hNAP2; NAP1L4b; MGC4565; |
Gene ID | 4676 |
mRNA Refseq | NM_005969 |
Protein Refseq | NP_005960 |
MIM | 601651 |
UniProt ID | Q99733 |
◆ Recombinant Proteins | ||
NAP1L4-1608C | Recombinant Chicken NAP1L4 | +Inquiry |
NAP1L4-3898R | Recombinant Rat NAP1L4 Protein | +Inquiry |
NAP1L4-2317H | Recombinant Human NAP1L4, His-tagged | +Inquiry |
Nap1l4-4290M | Recombinant Mouse Nap1l4 Protein, Myc/DDK-tagged | +Inquiry |
NAP1L4-301244H | Recombinant Human NAP1L4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAP1L4-3974HCL | Recombinant Human NAP1L4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAP1L4 Products
Required fields are marked with *
My Review for All NAP1L4 Products
Required fields are marked with *
0
Inquiry Basket