Recombinant Human NAP1L4 protein, His-tagged
| Cat.No. : | NAP1L4-3511H |
| Product Overview : | Recombinant Human NAP1L4 protein(1-375 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 08, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-375 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKSKVVVTEKAAATAEEPDPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVPNESFFNFFNPLKASGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NAP1L4 nucleosome assembly protein 1-like 4 [ Homo sapiens ] |
| Official Symbol | NAP1L4 |
| Synonyms | NAP1L4; nucleosome assembly protein 1-like 4; NAP2; NAP-2; nucleosome assembly protein 2; nucleosome assembly protein 1-like 4b; NAP2L; hNAP2; NAP1L4b; MGC4565; |
| Gene ID | 4676 |
| mRNA Refseq | NM_005969 |
| Protein Refseq | NP_005960 |
| MIM | 601651 |
| UniProt ID | Q99733 |
| ◆ Recombinant Proteins | ||
| NAP1L4-1608C | Recombinant Chicken NAP1L4 | +Inquiry |
| NAP1L4-301244H | Recombinant Human NAP1L4 protein, GST-tagged | +Inquiry |
| NAP1L4-1857H | Recombinant Human NAP1L4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NAP1L4-3511H | Recombinant Human NAP1L4 protein, His-tagged | +Inquiry |
| NAP1L4-3557R | Recombinant Rat NAP1L4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAP1L4-3974HCL | Recombinant Human NAP1L4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAP1L4 Products
Required fields are marked with *
My Review for All NAP1L4 Products
Required fields are marked with *
