Recombinant Human NAPA protein, T7-tagged
Cat.No. : | NAPA-127H |
Product Overview : | Recombinant human NAPA (295aa, Isoform-1) fused with T7 tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 295 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAA GNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELV DIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAAL CHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKT IQGDEEDLR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro autophage / Bcl2 mediated apoptosis regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development and cancer diagnostic development. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha [ Homo sapiens ] |
Official Symbol | NAPA |
Synonyms | SNAPA |
Gene ID | 8775 |
mRNA Refseq | NM_003827.3 |
Protein Refseq | NP_003818.2 |
MIM | 603215 |
UniProt ID | P54920 |
Chromosome Location | 19q13.33 |
Pathway | Clathrin derived vesicle budding, organism-specific biosystem;Golgi Associated Vesicle Biogenesis, organism-specific biosystem;Membrane Trafficking, organism-specific biosystem;Synaptic vesicle cycle, organism-specific biosystem;Synaptic vesicle cycle, conserved biosystem;trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
Function | protein binding;syntaxin binding; |
◆ Recombinant Proteins | ||
NAPA-636H | Recombinant Human NAPA protein, His-tagged | +Inquiry |
NAPA-471C | Recombinant Cynomolgus Monkey NAPA Protein, His (Fc)-Avi-tagged | +Inquiry |
NAPA-2766R | Recombinant Rhesus Macaque NAPA Protein, His (Fc)-Avi-tagged | +Inquiry |
NAPA-5905M | Recombinant Mouse NAPA Protein, His (Fc)-Avi-tagged | +Inquiry |
napA-13B | Recombinant Borrelia Burgdorferi napA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAPA-3972HCL | Recombinant Human NAPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAPA Products
Required fields are marked with *
My Review for All NAPA Products
Required fields are marked with *