"NAPA" Related Products

Expand

Recombinant Human NAPA protein, T7-tagged

Cat.No.: NAPA-127H
Product Overview: Recombinant human NAPA (295aa, Isoform-1) fused with T7 tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAA GNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELV DIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAAL CHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKT IQGDEEDLR
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro autophage / Bcl2 mediated apoptosis regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for ubiquitin assay.3. May be used for mapping protein–protein interaction assay.4. May be used as antigen for specific antibody development and cancer diagnostic development.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: NAPA N-ethylmaleimide-sensitive factor attachment protein, alpha [ Homo sapiens ]
Official Symbol: NAPA
Synonyms: SNAPA
Gene ID: 8775
mRNA Refseq: NM_003827.3
Protein Refseq: NP_003818.2
MIM: 603215
UniProt ID: P54920
Chromosome Location: 19q13.33
Pathway: Clathrin derived vesicle budding, organism-specific biosystem;Golgi Associated Vesicle Biogenesis, organism-specific biosystem;Membrane Trafficking, organism-specific biosystem;Synaptic vesicle cycle, organism-specific biosystem;Synaptic vesicle cycle, conserved biosystem;trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function: protein binding;syntaxin binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.