Recombinant Human NAPG protein, T7-tagged
Cat.No. : | NAPG-180H |
Product Overview : | Recombinant human NAPG (312 aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 312 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLR EAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQ LYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDY VAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSP ATPQAKPDGVTATAADEEEDEYSGGLC |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human neuronal cell differentiation regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder deseases.5. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | NAPG N-ethylmaleimide-sensitive factor attachment protein, gamma [ Homo sapiens ] |
Official Symbol | NAPG |
Synonyms | NAPG; N-ethylmaleimide-sensitive factor attachment protein, gamma; gamma-soluble NSF attachment protein; gamma SNAP; SNAP-gamma; soluble NSF attachment protein; GAMMASNAP; |
Gene ID | 8774 |
mRNA Refseq | NM_003826 |
Protein Refseq | NP_003817 |
MIM | 603216 |
UniProt ID | Q99747 |
Chromosome Location | 18p11.21 |
Function | protein binding; |
◆ Recombinant Proteins | ||
NAPG-10425M | Recombinant Mouse NAPG Protein | +Inquiry |
NAPG-2767R | Recombinant Rhesus Macaque NAPG Protein, His (Fc)-Avi-tagged | +Inquiry |
NAPG-2948H | Recombinant Human NAPG, His-tagged | +Inquiry |
NAPG-6876H | Recombinant Human N-Ethylmaleimide-Sensitive Factor Attachment Protein, Gamma, His-tagged | +Inquiry |
NAPG-4766H | Recombinant Human NAPG protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAPG-3970HCL | Recombinant Human NAPG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAPG Products
Required fields are marked with *
My Review for All NAPG Products
Required fields are marked with *
0
Inquiry Basket