Recombinant Human NAPG protein, T7-tagged

• Cat.No.: NAPG-180H
• Product Overview: Recombinant human NAPG (312 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 312 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLR EAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQ LYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDY VAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSP ATPQAKPDGVTATAADEEEDEYSGGLC
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human neuronal cell differentiation regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder deseases.5. As antigen for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: NAPG N-ethylmaleimide-sensitive factor attachment protein, gamma [ Homo sapiens ]
• Official Symbol: NAPG
• Synonyms: NAPG; N-ethylmaleimide-sensitive factor attachment protein, gamma; gamma-soluble NSF attachment protein; gamma SNAP; SNAP-gamma; soluble NSF attachment protein; GAMMASNAP
• Gene ID: 8774
• mRNA Refseq: NM_003826
• Protein Refseq: NP_003817
• MIM: 603216
• UniProt ID: Q99747
• Chromosome Location: 18p11.21
• Function: protein binding