Recombinant Human NARS

• Cat.No.: NARS-30281TH
• Product Overview: Recombinant fragment of Human NARS with N terminal proprietary tag. Predicted MW 37.40 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 107 amino acids
• Description: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids.Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases.The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases.
• Molecular Weight: 37.400kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIF DSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGL ERFLTWILNRYHIRDVCLYPRFVQRCT
• Sequence Similarities: Belongs to the class-II aminoacyl-tRNA synthetase family.

Gene Information

• Gene Name: NARS asparaginyl-tRNA synthetase [ Homo sapiens ]
• Official Symbol: NARS
• Synonyms: NARS; asparaginyl-tRNA synthetase; asparaginyl-tRNA synthetase, cytoplasmic; asparagine tRNA ligase 1; cytoplasmic; NARS1
• Gene ID: 4677
• mRNA Refseq: NM_004539
• Protein Refseq: NP_004530
• MIM: 108410
• Uniprot ID: O43776
• Chromosome Location: 18q21.31
• Pathway: Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem
• Function: ATP binding; asparagine-tRNA ligase activity; ligase activity; nucleic acid binding; nucleotide binding