Recombinant Human NARS

Cat.No. : NARS-30281TH
Product Overview : Recombinant fragment of Human NARS with N terminal proprietary tag. Predicted MW 37.40 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 107 amino acids
Description : Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids.Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases.The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases.
Molecular Weight : 37.400kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIF DSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGL ERFLTWILNRYHIRDVCLYPRFVQRCT
Sequence Similarities : Belongs to the class-II aminoacyl-tRNA synthetase family.
Gene Name NARS asparaginyl-tRNA synthetase [ Homo sapiens ]
Official Symbol NARS
Synonyms NARS; asparaginyl-tRNA synthetase; asparaginyl-tRNA synthetase, cytoplasmic; asparagine tRNA ligase 1; cytoplasmic; NARS1;
Gene ID 4677
mRNA Refseq NM_004539
Protein Refseq NP_004530
MIM 108410
Uniprot ID O43776
Chromosome Location 18q21.31
Pathway Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem;
Function ATP binding; asparagine-tRNA ligase activity; ligase activity; nucleic acid binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NARS Products

Required fields are marked with *

My Review for All NARS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon