Recombinant Human NARS
| Cat.No. : | NARS-30281TH |
| Product Overview : | Recombinant fragment of Human NARS with N terminal proprietary tag. Predicted MW 37.40 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 107 amino acids |
| Description : | Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids.Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases.The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases. |
| Molecular Weight : | 37.400kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIF DSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGL ERFLTWILNRYHIRDVCLYPRFVQRCT |
| Sequence Similarities : | Belongs to the class-II aminoacyl-tRNA synthetase family. |
| Gene Name | NARS asparaginyl-tRNA synthetase [ Homo sapiens ] |
| Official Symbol | NARS |
| Synonyms | NARS; asparaginyl-tRNA synthetase; asparaginyl-tRNA synthetase, cytoplasmic; asparagine tRNA ligase 1; cytoplasmic; NARS1; |
| Gene ID | 4677 |
| mRNA Refseq | NM_004539 |
| Protein Refseq | NP_004530 |
| MIM | 108410 |
| Uniprot ID | O43776 |
| Chromosome Location | 18q21.31 |
| Pathway | Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; |
| Function | ATP binding; asparagine-tRNA ligase activity; ligase activity; nucleic acid binding; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| NARS-8205H | Recombinant Human NARS protein, His & T7-tagged | +Inquiry |
| Nars-4294M | Recombinant Mouse Nars Protein, Myc/DDK-tagged | +Inquiry |
| NARS-10431M | Recombinant Mouse NARS Protein | +Inquiry |
| RFL11231MF | Recombinant Full Length Probable Sensor Histidine Kinase Nars(Nars) Protein, His-Tagged | +Inquiry |
| Nars-1672M | Recombinant Mouse Nars protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NARS-1167HCL | Recombinant Human NARS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NARS Products
Required fields are marked with *
My Review for All NARS Products
Required fields are marked with *



