Recombinant Human NAT10 protein, His-tagged
| Cat.No. : | NAT10-1190H |
| Product Overview : | Recombinant Human NAT10 protein(676-1025 aa), fused with His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 676-1025 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | EAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NAT10 N-acetyltransferase 10 (GCN5-related) [ Homo sapiens ] |
| Official Symbol | NAT10 |
| Synonyms | ALP; NET43 |
| Gene ID | 55226 |
| mRNA Refseq | NM_024662.2 |
| Protein Refseq | NP_078938.2 |
| MIM | 609221 |
| UniProt ID | Q9H0A0 |
| ◆ Recombinant Proteins | ||
| NAT10-10435M | Recombinant Mouse NAT10 Protein | +Inquiry |
| NAT10-645HFL | Recombinant Full Length Human NAT10 Protein, C-Flag-tagged | +Inquiry |
| NAT10-1190H | Recombinant Human NAT10 protein, His-tagged | +Inquiry |
| NAT10-4846HF | Recombinant Full Length Human NAT10 Protein, GST-tagged | +Inquiry |
| NAT10-1482H | Recombinant Human NAT10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NAT10-3965HCL | Recombinant Human NAT10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NAT10 Products
Required fields are marked with *
My Review for All NAT10 Products
Required fields are marked with *
