"NAT6" Related Products

Recombinant Human NAT6 protein, T7-tagged

Cat.No.: NAT6-163H
Product Overview: Recombinant human NAT6 (308 aa, Isoform_1) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGP TELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPT LEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGY QLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPS KSLLETQYQNVRGRPIFWMEKDI
Purity: >90% by SDS-PAGE
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: NAT6 N-acetyltransferase 6 (GCN5-related) [ Homo sapiens ]
Official Symbol: NAT6
Synonyms: NAT6; N-acetyltransferase 6 (GCN5-related); N acetyltransferase 6; N-acetyltransferase 6; FUS2; protein fusion-2; FUS-2;
Gene ID: 24142
mRNA Refseq: NM_001200016
Protein Refseq: NP_001186945
MIM: 607073
UniProt ID: Q93015
Chromosome Location: 3p21.3
Function: N-acetyltransferase activity; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.