Recombinant Human NAV1 protein, GST-tagged
Cat.No. : | NAV1-3690H |
Product Overview : | Recombinant Human NAV1 protein(1359-1530 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1359-1530 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | LKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIHGYSISHVKRVLDAEPPEMPPCRRGVNNISVSLKGLKEKCVDSL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NAV1 neuron navigator 1 [ Homo sapiens ] |
Official Symbol | NAV1 |
Synonyms | NAV1; neuron navigator 1; DKFZp781D0314; FLJ12560; FLJ14203; KIAA1151; MGC14961; POMFIL3; pore membrane and/or filament interacting like protein 3; steerin 1; unc-53 homolog 1; neuron navigator-1; pore membrane and/or filament-interacting-like protein 3; UNC53H1; STEERIN1; |
Gene ID | 89796 |
mRNA Refseq | NM_001167738 |
Protein Refseq | NP_001161210 |
MIM | 611628 |
UniProt ID | Q8NEY1 |
◆ Recombinant Proteins | ||
NAV1-1029H | Recombinant Human NAV1 protein, His-tagged | +Inquiry |
NAV1-1198H | Recombinant Human NAV1 protein, His-tagged | +Inquiry |
NAV1-1028H | Recombinant Human NAV1 protein, His-tagged | +Inquiry |
NAV1-3690H | Recombinant Human NAV1 protein, GST-tagged | +Inquiry |
NAV1-10443M | Recombinant Mouse NAV1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NAV1 Products
Required fields are marked with *
My Review for All NAV1 Products
Required fields are marked with *
0
Inquiry Basket