Recombinant Human NBR1 protein, His-tagged
| Cat.No. : | NBR1-3368H |
| Product Overview : | Recombinant Human NBR1 protein(1-353 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-353 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NBR1 neighbor of BRCA1 gene 1 [ Homo sapiens ] |
| Official Symbol | NBR1 |
| Synonyms | NBR1; neighbor of BRCA1 gene 1; M17S2, membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); next to BRCA1 gene 1 protein; 1A1 3B; CA125; KIAA0049; protein 1A1-3B; migration-inducing protein 19; neighbor of BRCA1 gene 1 protein; cell migration-inducing gene 19 protein; membrane component chromosome 17 surface marker 2; membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); M17S2; MIG19; 1A1-3B; FLJ55359; FLJ98272; |
| Gene ID | 4077 |
| mRNA Refseq | NM_005899 |
| Protein Refseq | NP_005890 |
| MIM | 166945 |
| UniProt ID | Q14596 |
| ◆ Recombinant Proteins | ||
| NBR1-27854TH | Recombinant Human NBR1 | +Inquiry |
| NBR1-912M | Recombinant Mouse ear watercress NBR1 protein, His-tagged | +Inquiry |
| NBR1-3368H | Recombinant Human NBR1 protein, His-tagged | +Inquiry |
| NBR1-3572R | Recombinant Rat NBR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NBR1-3913R | Recombinant Rat NBR1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NBR1-3956HCL | Recombinant Human NBR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NBR1 Products
Required fields are marked with *
My Review for All NBR1 Products
Required fields are marked with *
