Recombinant Human NCAN Protein, GST-tagged
Cat.No. : | NCAN-2014H |
Product Overview : | Human CSPG3 partial ORF ( NP_004377, 81 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Neurocan is a chondroitin sulfate proteoglycan thought to be involved in the modulation of cell adhesion and migration.[supplied by OMIM, Jul 2002] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | VRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NCAN neurocan [ Homo sapiens ] |
Official Symbol | NCAN |
Synonyms | NCAN; neurocan; chondroitin sulfate proteoglycan 3 , CSPG3; neurocan core protein; neurocan proteoglycan; chondroitin sulfate proteoglycan 3 (neurocan); CSPG3; FLJ44681; |
Gene ID | 1463 |
mRNA Refseq | NM_004386 |
Protein Refseq | NP_004377 |
MIM | 600826 |
UniProt ID | O14594 |
◆ Recombinant Proteins | ||
NCAN-6305C | Recombinant Chicken NCAN | +Inquiry |
NCAN-2014H | Recombinant Human NCAN Protein, GST-tagged | +Inquiry |
NCAN-10455M | Recombinant Mouse NCAN Protein | +Inquiry |
NCAN-374H | Recombinant Human NCAN Protein, His-tagged | +Inquiry |
NCAN-3591H | Recombinant Human NCAN Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCAN Products
Required fields are marked with *
My Review for All NCAN Products
Required fields are marked with *
0
Inquiry Basket