Recombinant Human NCAN Protein, GST-tagged

Cat.No. : NCAN-2014H
Product Overview : Human CSPG3 partial ORF ( NP_004377, 81 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Neurocan is a chondroitin sulfate proteoglycan thought to be involved in the modulation of cell adhesion and migration.[supplied by OMIM, Jul 2002]
Molecular Mass : 36.63 kDa
AA Sequence : VRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NCAN neurocan [ Homo sapiens ]
Official Symbol NCAN
Synonyms NCAN; neurocan; chondroitin sulfate proteoglycan 3 , CSPG3; neurocan core protein; neurocan proteoglycan; chondroitin sulfate proteoglycan 3 (neurocan); CSPG3; FLJ44681;
Gene ID 1463
mRNA Refseq NM_004386
Protein Refseq NP_004377
MIM 600826
UniProt ID O14594

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCAN Products

Required fields are marked with *

My Review for All NCAN Products

Required fields are marked with *

0
cart-icon