Recombinant Human NCAPG2 Protein, GST-tagged

Cat.No. : NCAPG2-4576H
Product Overview : Human LUZP5 partial ORF ( NP_060230, 177 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPG2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM
Molecular Mass : 36.52 kDa
AA Sequence : TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NCAPG2 non-SMC condensin II complex, subunit G2 [ Homo sapiens ]
Official Symbol NCAPG2
Synonyms NCAPG2; non-SMC condensin II complex, subunit G2; leucine zipper protein 5 , LUZP5; condensin-2 complex subunit G2; CAP G2; FLJ20311; hCAP G2; MTB; more than blood homolog; leucine zipper protein 5; chromosome-associated protein G2; LUZP5; CAP-G2; hCAP-G2;
Gene ID 54892
mRNA Refseq NM_017760
Protein Refseq NP_060230
MIM 608532
UniProt ID Q86XI2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCAPG2 Products

Required fields are marked with *

My Review for All NCAPG2 Products

Required fields are marked with *

0
cart-icon