Recombinant Human NCAPG2 Protein, GST-tagged
Cat.No. : | NCAPG2-4576H |
Product Overview : | Human LUZP5 partial ORF ( NP_060230, 177 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPG2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM |
Molecular Mass : | 36.52 kDa |
AA Sequence : | TKTGADVCRLWRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRRFLSCLFNWNINFIKMIHGTIKNQLQGLQKSLMVYIAEIYFRAWKKAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NCAPG2 non-SMC condensin II complex, subunit G2 [ Homo sapiens ] |
Official Symbol | NCAPG2 |
Synonyms | NCAPG2; non-SMC condensin II complex, subunit G2; leucine zipper protein 5 , LUZP5; condensin-2 complex subunit G2; CAP G2; FLJ20311; hCAP G2; MTB; more than blood homolog; leucine zipper protein 5; chromosome-associated protein G2; LUZP5; CAP-G2; hCAP-G2; |
Gene ID | 54892 |
mRNA Refseq | NM_017760 |
Protein Refseq | NP_060230 |
MIM | 608532 |
UniProt ID | Q86XI2 |
◆ Recombinant Proteins | ||
NCAPG2-4576H | Recombinant Human NCAPG2 Protein, GST-tagged | +Inquiry |
NCAPG2-2953R | Recombinant Rhesus monkey NCAPG2 Protein, His-tagged | +Inquiry |
NCAPG2-2772R | Recombinant Rhesus Macaque NCAPG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCAPG2-5592Z | Recombinant Zebrafish NCAPG2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCAPG2 Products
Required fields are marked with *
My Review for All NCAPG2 Products
Required fields are marked with *
0
Inquiry Basket