Recombinant Human NCR3LG1 protein, His-tagged
Cat.No. : | NCR3LG1-4707H |
Product Overview : | Recombinant Human NCR3LG1 protein(Q68D85)(25-262 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 25-262 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 28.7 kDa |
AASequence : | DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
◆ Recombinant Proteins | ||
Ncr3lg1-1156R | Active Recombinant Rat Ncr3lg1 protein, hFc-tagged | +Inquiry |
Ncr3lg1-1157R | Recombinant Rat Ncr3lg1 Protein, His-tagged | +Inquiry |
NCR3LG1-3817H | Recombinant Human NCR3LG1 Protein (Met1-Ser262), C-His tagged | +Inquiry |
NCR3LG1-546H | Recombinant Human NCR3LG1 protein, hFc-tagged | +Inquiry |
NCR3LG1-2941H | Active Recombinant Human NCR3LG1 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCR3LG1 Products
Required fields are marked with *
My Review for All NCR3LG1 Products
Required fields are marked with *