Recombinant Human NCR3LG1 protein, His-tagged
| Cat.No. : | NCR3LG1-4707H |
| Product Overview : | Recombinant Human NCR3LG1 protein(Q68D85)(25-262 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 25-262 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 28.7 kDa |
| AASequence : | DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| ◆ Recombinant Proteins | ||
| NCR3LG1-051H | Active Recombinant Human NCR3LG1 protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
| NCR3LG1-1522R | Recombinant Rhesus Monkey NCR3LG1 Protein, hIgG4-tagged | +Inquiry |
| NCR3LG1-3818H | Recombinant Human NCR3LG1 Protein (Asp25-Ser262), N-His tagged | +Inquiry |
| NCR3LG1-706H | Active Recombinant Human NCR3LG1, Fc Chimera | +Inquiry |
| NCR3LG1-120C | Recombinant Cynomolgus NCR3LG1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCR3LG1 Products
Required fields are marked with *
My Review for All NCR3LG1 Products
Required fields are marked with *
