Recombinant Human NDC80, His-tagged
Cat.No. : | NDC80-27986TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 350-642 of Human HEC1 with N terminal His tag; MWt 37 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 350-642 a.a. |
Description : | This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 68 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEA EQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPK GAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELL NETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTL KEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLE STVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNN LQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDL SENIKEIRDKYEKKATLIKSSEE |
Sequence Similarities : | Belongs to the NDC80/HEC1 family. |
Gene Name | NDC80 NDC80 homolog, kinetochore complex component (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NDC80 |
Synonyms | NDC80; NDC80 homolog, kinetochore complex component (S. cerevisiae); highly expressed in cancer, rich in leucine heptad repeats (yeast) , kinetochore associated 2 , KNTC2; kinetochore protein NDC80 homolog; HEC; HEC1; hsNDC80; TID3; |
Gene ID | 10403 |
mRNA Refseq | NM_006101 |
Protein Refseq | NP_006092 |
MIM | 607272 |
Uniprot ID | O14777 |
Chromosome Location | 18p11.31 |
Pathway | Aurora B signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
NDC80-10493M | Recombinant Mouse NDC80 Protein | +Inquiry |
NDC80-2782R | Recombinant Rhesus Macaque NDC80 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDC80-18H | Recombinant Human NDC80 protein, MYC/DDK-tagged | +Inquiry |
NDC80-5949M | Recombinant Mouse NDC80 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDC80-730C | Recombinant Cynomolgus NDC80 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDC80-952HCL | Recombinant Human NDC80 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDC80 Products
Required fields are marked with *
My Review for All NDC80 Products
Required fields are marked with *