Recombinant Human NDC80 Protein, GST-tagged

Cat.No. : NDC80-4899H
Product Overview : Human KNTC2 partial ORF ( AAH35617, 545 a.a. - 642 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HEC is one of several proteins involved in spindle checkpoint signaling. This surveillance mechanism assures correct segregation of chromosomes during cell division by detecting unaligned chromosomes and causing prometaphase arrest until the proper bipolar attachment of chromosomes is achieved.[supplied by OMIM
Molecular Mass : 36.19 kDa
AA Sequence : TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NDC80 NDC80 kinetochore complex component homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol NDC80
Synonyms NDC80; NDC80 kinetochore complex component homolog (S. cerevisiae); highly expressed in cancer, rich in leucine heptad repeats (yeast) , kinetochore associated 2 , KNTC2; kinetochore protein NDC80 homolog; HEC; HEC1; hsNDC80; TID3; kinetochore associated 2; kinetochore protein Hec1; kinetochore-associated protein 2; highly expressed in cancer protein; retinoblastoma-associated protein HEC; NDC80 homolog, kinetochore complex component; highly expressed in cancer, rich in leucine heptad repeats; KNTC2; HsHec1;
Gene ID 10403
mRNA Refseq NM_006101
Protein Refseq NP_006092
MIM 607272
UniProt ID O14777

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDC80 Products

Required fields are marked with *

My Review for All NDC80 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon