Recombinant Human NDC80 Protein, GST-tagged
Cat.No. : | NDC80-4899H |
Product Overview : | Human KNTC2 partial ORF ( AAH35617, 545 a.a. - 642 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HEC is one of several proteins involved in spindle checkpoint signaling. This surveillance mechanism assures correct segregation of chromosomes during cell division by detecting unaligned chromosomes and causing prometaphase arrest until the proper bipolar attachment of chromosomes is achieved.[supplied by OMIM |
Molecular Mass : | 36.19 kDa |
AA Sequence : | TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NDC80 NDC80 kinetochore complex component homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NDC80 |
Synonyms | NDC80; NDC80 kinetochore complex component homolog (S. cerevisiae); highly expressed in cancer, rich in leucine heptad repeats (yeast) , kinetochore associated 2 , KNTC2; kinetochore protein NDC80 homolog; HEC; HEC1; hsNDC80; TID3; kinetochore associated 2; kinetochore protein Hec1; kinetochore-associated protein 2; highly expressed in cancer protein; retinoblastoma-associated protein HEC; NDC80 homolog, kinetochore complex component; highly expressed in cancer, rich in leucine heptad repeats; KNTC2; HsHec1; |
Gene ID | 10403 |
mRNA Refseq | NM_006101 |
Protein Refseq | NP_006092 |
MIM | 607272 |
UniProt ID | O14777 |
◆ Recombinant Proteins | ||
NDC80-3846H | Recombinant Human NDC80 protein, His-tagged | +Inquiry |
NDC80-10493M | Recombinant Mouse NDC80 Protein | +Inquiry |
NDC80-1150Z | Recombinant Zebrafish NDC80 | +Inquiry |
NDC80-18H | Recombinant Human NDC80 protein, MYC/DDK-tagged | +Inquiry |
NDC80-2963R | Recombinant Rhesus monkey NDC80 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDC80-952HCL | Recombinant Human NDC80 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDC80 Products
Required fields are marked with *
My Review for All NDC80 Products
Required fields are marked with *