Recombinant Human NDC80 Protein, GST-tagged

• Cat.No.: NDC80-4899H
• Product Overview: Human KNTC2 partial ORF ( AAH35617, 545 a.a. - 642 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HEC is one of several proteins involved in spindle checkpoint signaling. This surveillance mechanism assures correct segregation of chromosomes during cell division by detecting unaligned chromosomes and causing prometaphase arrest until the proper bipolar attachment of chromosomes is achieved.[supplied by OMIM
• Molecular Mass: 36.19 kDa
• AA Sequence: TVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NDC80 NDC80 kinetochore complex component homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: NDC80
• Synonyms: NDC80; NDC80 kinetochore complex component homolog (S. cerevisiae); highly expressed in cancer, rich in leucine heptad repeats (yeast) , kinetochore associated 2 , KNTC2; kinetochore protein NDC80 homolog; HEC; HEC1; hsNDC80; TID3; kinetochore associated 2; kinetochore protein Hec1; kinetochore-associated protein 2; highly expressed in cancer protein; retinoblastoma-associated protein HEC; NDC80 homolog, kinetochore complex component; highly expressed in cancer, rich in leucine heptad repeats; KNTC2; HsHec1
• Gene ID: 10403
• mRNA Refseq: NM_006101
• Protein Refseq: NP_006092
• MIM: 607272
• UniProt ID: O14777