Recombinant Human NDE1, His-tagged
Cat.No. : | NDE1-28795TH |
Product Overview : | Recombinant full length Human NDE1, isoform 2 (amino acids 1-335) with N terminal His tag; 355 amino acids, 39.9 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Alternative splicing results in multiple transcript variants. |
Protein length : | 335 amino acids |
Conjugation : | HIS |
Molecular Weight : | 39.900kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.08% DTT, 1.17% Sodium chloride |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEDSGKTFSSEEEEANYWKD LAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETR NRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDL AQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQEL AVQQKQEKPRTPMPSSVEAERTDTAVQATGSVPSTPIAHR GPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDL LRKVGALESKLASCRNLVYDQSPNRTGGPASGRSSKNRDG GERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC |
Sequence Similarities : | Belongs to the nudE family. |
Gene Name : | NDE1 nudE nuclear distribution gene E homolog 1 (A. nidulans) [ Homo sapiens ] |
Official Symbol : | NDE1 |
Synonyms : | NDE1; nudE nuclear distribution gene E homolog 1 (A. nidulans); nuclear distribution protein nudE homolog 1; FLJ20101; NUDE; |
Gene ID : | 54820 |
mRNA Refseq : | NM_001143979 |
Protein Refseq : | NP_001137451 |
MIM : | 609449 |
Uniprot ID : | Q9NXR1 |
Chromosome Location : | 16p13.11 |
Pathway : | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; DNA Replication, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; |
Function : | microtubule binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Nde1-4320M | Recombinant Mouse Nde1 Protein, Myc/DDK-tagged | +Inquiry |
NDE1-2783R | Recombinant Rhesus Macaque NDE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDE1-3584R | Recombinant Rat NDE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDE1-5950M | Recombinant Mouse NDE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDE1-3303Z | Recombinant Zebrafish NDE1 | +Inquiry |
◆ Lysates | ||
NDE1-3938HCL | Recombinant Human NDE1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket