Recombinant Human NDE1, His-tagged
Cat.No. : | NDE1-28795TH |
Product Overview : | Recombinant full length Human NDE1, isoform 2 (amino acids 1-335) with N terminal His tag; 355 amino acids, 39.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 335 amino acids |
Description : | This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Molecular Weight : | 39.900kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.08% DTT, 1.17% Sodium chloride |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEDSGKTFSSEEEEANYWKD LAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETR NRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDL AQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQEL AVQQKQEKPRTPMPSSVEAERTDTAVQATGSVPSTPIAHR GPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDL LRKVGALESKLASCRNLVYDQSPNRTGGPASGRSSKNRDG GERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC |
Sequence Similarities : | Belongs to the nudE family. |
Gene Name | NDE1 nudE nuclear distribution gene E homolog 1 (A. nidulans) [ Homo sapiens ] |
Official Symbol | NDE1 |
Synonyms | NDE1; nudE nuclear distribution gene E homolog 1 (A. nidulans); nuclear distribution protein nudE homolog 1; FLJ20101; NUDE; |
Gene ID | 54820 |
mRNA Refseq | NM_001143979 |
Protein Refseq | NP_001137451 |
MIM | 609449 |
Uniprot ID | Q9NXR1 |
Chromosome Location | 16p13.11 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; DNA Replication, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; |
Function | microtubule binding; protein binding; |
◆ Recombinant Proteins | ||
NDE1-10494M | Recombinant Mouse NDE1 Protein | +Inquiry |
NDE1-5533H | Recombinant Human NDE1 protein, His&Myc-tagged | +Inquiry |
NDE1-3584R | Recombinant Rat NDE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDE1-1218H | Recombinant Human NDE1, GST-tagged | +Inquiry |
Nde1-4320M | Recombinant Mouse Nde1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDE1-3938HCL | Recombinant Human NDE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDE1 Products
Required fields are marked with *
My Review for All NDE1 Products
Required fields are marked with *