Recombinant Human NDNL2 protein, His-tagged

Cat.No. : NDNL2-4676H
Product Overview : Recombinant Human NDNL2 protein(1-90 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-90 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name NDNL2 necdin-like 2 [ Homo sapiens ]
Official Symbol NDNL2
Synonyms NDNL2; necdin-like 2; melanoma-associated antigen G1; HCA4; MAGEG1; MAGEL3; NSE3; NSMCE3; MAGE-G1 antigen; necdin-like gene 2; necdin-like protein 2; melanoma antigen, family G, 1; hepatocellular carcinoma-associated protein 4; hepatocellular carcinoma-associated protein HCA4;
Gene ID 56160
mRNA Refseq NM_138704
Protein Refseq NP_619649
MIM 608243
UniProt ID Q96MG7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDNL2 Products

Required fields are marked with *

My Review for All NDNL2 Products

Required fields are marked with *

0
cart-icon