Recombinant Human NDNL2 protein, His-tagged
Cat.No. : | NDNL2-4676H |
Product Overview : | Recombinant Human NDNL2 protein(1-90 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-90 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NDNL2 necdin-like 2 [ Homo sapiens ] |
Official Symbol | NDNL2 |
Synonyms | NDNL2; necdin-like 2; melanoma-associated antigen G1; HCA4; MAGEG1; MAGEL3; NSE3; NSMCE3; MAGE-G1 antigen; necdin-like gene 2; necdin-like protein 2; melanoma antigen, family G, 1; hepatocellular carcinoma-associated protein 4; hepatocellular carcinoma-associated protein HCA4; |
Gene ID | 56160 |
mRNA Refseq | NM_138704 |
Protein Refseq | NP_619649 |
MIM | 608243 |
UniProt ID | Q96MG7 |
◆ Recombinant Proteins | ||
NDNL2-2968R | Recombinant Rhesus monkey NDNL2 Protein, His-tagged | +Inquiry |
NDNL2-10500M | Recombinant Mouse NDNL2 Protein | +Inquiry |
NDNL2-2787R | Recombinant Rhesus Macaque NDNL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDNL2-3747C | Recombinant Chicken NDNL2 | +Inquiry |
NDNL2-5955M | Recombinant Mouse NDNL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDNL2 Products
Required fields are marked with *
My Review for All NDNL2 Products
Required fields are marked with *