Recombinant Human NDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NDRG1-4782H
• Product Overview: NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_001128714) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Molecular Mass: 42.8 kDa
• AA Sequence: MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NDRG1 N-myc downstream regulated 1 [ Homo sapiens (human) ]
• Official Symbol: NDRG1
• Synonyms: NDRG1; N-myc downstream regulated 1; CAP43; protein NDRG1; DRG1; NDR1; RTP; TDD5; DRG-1; protein regulated by oxygen-1; tunicamycin-responsive protein; differentiation-related gene 1 protein; nickel-specific induction protein Cap43; N-myc downstream-regulated gene 1 protein; reducing agents and tunicamycin-responsive protein; GC4; NMSL; CMT4D; HMSNL; RIT42; TARG1; PROXY1
• Gene ID: 10397
• mRNA Refseq: NM_001135242
• Protein Refseq: NP_001128714
• MIM: 605262
• UniProt ID: Q92597