Recombinant Human NDRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NDRG1-4782H
Product Overview : NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_001128714) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Molecular Mass : 42.8 kDa
AA Sequence : MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NDRG1 N-myc downstream regulated 1 [ Homo sapiens (human) ]
Official Symbol NDRG1
Synonyms NDRG1; N-myc downstream regulated 1; CAP43; protein NDRG1; DRG1; NDR1; RTP; TDD5; DRG-1; protein regulated by oxygen-1; tunicamycin-responsive protein; differentiation-related gene 1 protein; nickel-specific induction protein Cap43; N-myc downstream-regulated gene 1 protein; reducing agents and tunicamycin-responsive protein; GC4; NMSL; CMT4D; HMSNL; RIT42; TARG1; PROXY1;
Gene ID 10397
mRNA Refseq NM_001135242
Protein Refseq NP_001128714
MIM 605262
UniProt ID Q92597

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDRG1 Products

Required fields are marked with *

My Review for All NDRG1 Products

Required fields are marked with *

0
cart-icon
0
compare icon