Recombinant Human NDST1 protein, His-tagged
Cat.No. : | NDST1-3940H |
Product Overview : | Recombinant Human NDST1 protein(38-90 aa), fused to His tag, was expressed in E. coli. |
Availability | October 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 38-90 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NDST1 N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1 [ Homo sapiens ] |
Official Symbol | NDST1 |
Synonyms | NDST1; N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1; HSST; bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1; NST1; NDST-1; HSNST 1; N-HSST 1; N-heparan sulfate sulfotransferase 1; glucosaminyl N-deacetylase/N-sulfotransferase 1; heparan sulfate-N-deacetylase/N-sulfotransferase; [Heparan sulfate]-glucosamine N-sulfotransferase 1; |
Gene ID | 3340 |
mRNA Refseq | NM_001543 |
Protein Refseq | NP_001534 |
MIM | 600853 |
UniProt ID | P52848 |
◆ Recombinant Proteins | ||
NDST1-3932R | Recombinant Rat NDST1 Protein | +Inquiry |
NDST1-1092H | Recombinant Human NDST1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDST1-3940H | Recombinant Human NDST1 protein, His-tagged | +Inquiry |
NDST1-2789R | Recombinant Rhesus Macaque NDST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDST1-2970R | Recombinant Rhesus monkey NDST1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDST1-435HCL | Recombinant Human NDST1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDST1 Products
Required fields are marked with *
My Review for All NDST1 Products
Required fields are marked with *