Recombinant Human NDUFA12 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NDUFA12-699H |
Product Overview : | NDUFA12 MS Standard C13 and N15-labeled recombinant protein (NP_061326) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NDUFA12 NADH:ubiquinone oxidoreductase subunit A12 [ Homo sapiens (human) ] |
Official Symbol | NDUFA12 |
Synonyms | NDUFA12; B17.2; DAP13; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12; CI-B17.2; complex I B17.2 subunit; 13 kDa differentiation-associated protein; NADH-ubiquinone oxidoreductase subunit B17.2; EC 1.6.5.3; EC 1.6.99.3 |
Gene ID | 55967 |
mRNA Refseq | NM_018838 |
Protein Refseq | NP_061326 |
MIM | 614530 |
UniProt ID | Q9UI09 |
◆ Recombinant Proteins | ||
NDUFA12-699H | Recombinant Human NDUFA12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ndufa12-4328M | Recombinant Mouse Ndufa12 Protein, Myc/DDK-tagged | +Inquiry |
NDUFA12-4099C | Recombinant Chicken NDUFA12 | +Inquiry |
NDUFA12-1232H | Recombinant Human NDUFA12 | +Inquiry |
NDUFA12-3389Z | Recombinant Zebrafish NDUFA12 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA12-3923HCL | Recombinant Human NDUFA12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFA12 Products
Required fields are marked with *
My Review for All NDUFA12 Products
Required fields are marked with *
0
Inquiry Basket