Recombinant Human NDUFA12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NDUFA12-699H
Product Overview : NDUFA12 MS Standard C13 and N15-labeled recombinant protein (NP_061326) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants.
Molecular Mass : 17.1 kDa
AA Sequence : MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NDUFA12 NADH:ubiquinone oxidoreductase subunit A12 [ Homo sapiens (human) ]
Official Symbol NDUFA12
Synonyms NDUFA12; B17.2; DAP13; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12; CI-B17.2; complex I B17.2 subunit; 13 kDa differentiation-associated protein; NADH-ubiquinone oxidoreductase subunit B17.2; EC 1.6.5.3; EC 1.6.99.3
Gene ID 55967
mRNA Refseq NM_018838
Protein Refseq NP_061326
MIM 614530
UniProt ID Q9UI09

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFA12 Products

Required fields are marked with *

My Review for All NDUFA12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon