Recombinant Human NDUFA3 protein, GST-tagged
Cat.No. : | NDUFA3-3268H |
Product Overview : | Recombinant Human NDUFA3 protein(O95167)(2-84aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-84aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NDUFA3 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa [ Homo sapiens ] |
Official Symbol | NDUFA3 |
Synonyms | NDUFA3; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 (9kD, B9); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3; B9; complex I B9 subunit; complex I-B9; NADH-ubiquinone oxidoreductase B9 subunit; CI-B9; |
Gene ID | 4696 |
mRNA Refseq | NM_004542 |
Protein Refseq | NP_004533 |
MIM | 603832 |
UniProt ID | O95167 |
◆ Recombinant Proteins | ||
NDUFA3-128H | Recombinant Human NDUFA3 Protein, GST/His-tagged | +Inquiry |
NDUFA3-3268H | Recombinant Human NDUFA3 protein, GST-tagged | +Inquiry |
NDUFA3-10516M | Recombinant Mouse NDUFA3 Protein | +Inquiry |
NDUFA3-5967M | Recombinant Mouse NDUFA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17521PF | Recombinant Full Length Pan Troglodytes Nadh Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 3(Ndufa3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA3-3920HCL | Recombinant Human NDUFA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA3 Products
Required fields are marked with *
My Review for All NDUFA3 Products
Required fields are marked with *