Recombinant Human NDUFA5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NDUFA5-5090H
Product Overview : NDUFA5 MS Standard C13 and N15-labeled recombinant protein (NP_004991) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16.
Molecular Mass : 13.5 kDa
AA Sequence : MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NDUFA5 NADH:ubiquinone oxidoreductase subunit A5 [ Homo sapiens (human) ]
Official Symbol NDUFA5
Synonyms NDUFA5; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 (13kD, B13); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; B13; CI 13kB; CI 13KD B; complex I 13kDa subunit B; NADH ubiquinone oxidoreductase 13 kDa B subunit; NUFM; type I dehydrogenase; ubiquinone reductase; UQOR13; Complex I-13KD-B; complex I subunit B13; NADH-ubiquinone oxidoreductase 13 kDa-B subunit; CI-13kB; CI-13KD-B; FLJ12147; DKFZp781K1356;
Gene ID 4698
mRNA Refseq NM_005000
Protein Refseq NP_004991
MIM 601677
UniProt ID Q16718

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFA5 Products

Required fields are marked with *

My Review for All NDUFA5 Products

Required fields are marked with *

0
cart-icon
0
compare icon