Recombinant Human NDUFA9

Cat.No. : NDUFA9-28709TH
Product Overview : Recombinant fragment of Human NDUFA9 with N terminal proprietary tag, predicted mwt: 33.88 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 75 amino acids
Description : The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12.
Molecular Weight : 33.880kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
Sequence Similarities : Belongs to the complex I NDUFA9 subunit family.
Gene Name NDUFA9 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa [ Homo sapiens ]
Official Symbol NDUFA9
Synonyms NDUFA9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD) , NDUFS2L; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial; CI 39k; complex I 39kDa subunit; SDR
Gene ID 4704
mRNA Refseq NM_005002
Protein Refseq NP_004993
MIM 603834
Uniprot ID Q16795
Chromosome Location 12p13.3
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; NADH dehydrogenase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFA9 Products

Required fields are marked with *

My Review for All NDUFA9 Products

Required fields are marked with *

0
cart-icon
0
compare icon