Recombinant Human NDUFAB1 protein, GST-tagged
Cat.No. : | NDUFAB1-01H |
Product Overview : | Recombinant Human NDUFAB1 protein(NP_004994)(1-156 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 1-156 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPYIDAEKLMCPQEIVDYIADKKDVYE |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | NDUFAB1 NADH:ubiquinone oxidoreductase subunit AB1 [ Homo sapiens (human) ] |
Official Symbol | NDUFAB1 |
Synonyms | ACP; ACP1; SDAP; FASN2A |
Gene ID | 4706 |
mRNA Refseq | NM_005003.3 |
Protein Refseq | NP_004994.1 |
MIM | 603836 |
UniProt ID | O14561 |
◆ Recombinant Proteins | ||
NDUFAB1-713H | Recombinant Human NDUFAB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDUFAB1-2796R | Recombinant Rhesus Macaque NDUFAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFAB1-3124H | Recombinant Human NDUFAB1, GST-tagged | +Inquiry |
Ndufab1-505M | Recombinant Mouse Ndufab1 Protein, His-tagged | +Inquiry |
NDUFAB1-504H | Recombinant Human NDUFAB1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFAB1-3913HCL | Recombinant Human NDUFAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFAB1 Products
Required fields are marked with *
My Review for All NDUFAB1 Products
Required fields are marked with *