Recombinant Human NDUFAB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NDUFAB1-713H
Product Overview : NDUFAB1 MS Standard C13 and N15-labeled recombinant protein (NP_004994) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Carrier of the growing fatty acid chain in fatty acid biosynthesis. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.
Molecular Mass : 17.2 kDa
AA Sequence : MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NDUFAB1 NADH:ubiquinone oxidoreductase subunit AB1 [ Homo sapiens (human) ]
Official Symbol NDUFAB1
Synonyms NDUFAB1; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (8kD, SDAP); acyl carrier protein, mitochondrial; ACP; acyl carrier protein; mitochondrial; complex I SDAP subunit; FASN2A; SDAP; CI-SDAP; mitochondrial acyl carrier protein; NADH:ubiquinone oxidoreductase SDAP subunit; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; MGC65095;
Gene ID 4706
mRNA Refseq NM_005003
Protein Refseq NP_004994
MIM 603836
UniProt ID O14561

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFAB1 Products

Required fields are marked with *

My Review for All NDUFAB1 Products

Required fields are marked with *

0
cart-icon