Recombinant Human NDUFAB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NDUFAB1-713H |
Product Overview : | NDUFAB1 MS Standard C13 and N15-labeled recombinant protein (NP_004994) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Carrier of the growing fatty acid chain in fatty acid biosynthesis. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. |
Molecular Mass : | 17.2 kDa |
AA Sequence : | MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NDUFAB1 NADH:ubiquinone oxidoreductase subunit AB1 [ Homo sapiens (human) ] |
Official Symbol | NDUFAB1 |
Synonyms | NDUFAB1; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (8kD, SDAP); acyl carrier protein, mitochondrial; ACP; acyl carrier protein; mitochondrial; complex I SDAP subunit; FASN2A; SDAP; CI-SDAP; mitochondrial acyl carrier protein; NADH:ubiquinone oxidoreductase SDAP subunit; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; MGC65095; |
Gene ID | 4706 |
mRNA Refseq | NM_005003 |
Protein Refseq | NP_004994 |
MIM | 603836 |
UniProt ID | O14561 |
◆ Recombinant Proteins | ||
NDUFAB1-2796R | Recombinant Rhesus Macaque NDUFAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACP-3123H | Recombinant Human ACP | +Inquiry |
NDUFAB1-1228H | Recombinant Human NDUFAB1, His-tagged | +Inquiry |
NDUFAB1-2977R | Recombinant Rhesus monkey NDUFAB1 Protein, His-tagged | +Inquiry |
NDUFAB1-713H | Recombinant Human NDUFAB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFAB1-3913HCL | Recombinant Human NDUFAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFAB1 Products
Required fields are marked with *
My Review for All NDUFAB1 Products
Required fields are marked with *