Recombinant Human NDUFAF2 protein, His-tagged
| Cat.No. : | NDUFAF2-1230H |
| Product Overview : | Recombinant Human NDUFAF2 protein(1-169 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-169 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NDUFAF2 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 [ Homo sapiens ] |
| Official Symbol | NDUFAF2 |
| Synonyms | NDUFAF2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2; NDUFA12 like , NDUFA12L; mimitin, mitochondrial; B17.2L; mimitin; MMTN; Myc induced mitochondrial protein; NDUFA12-like protein; Myc-induced mitochondrial protein; NDUFA12L; FLJ22398; |
| Gene ID | 91942 |
| mRNA Refseq | NM_174889 |
| Protein Refseq | NP_777549 |
| MIM | 609653 |
| UniProt ID | Q8N183 |
| ◆ Recombinant Proteins | ||
| NDUFAF2-30238TH | Recombinant Human NDUFAF2, His-tagged | +Inquiry |
| NDUFAF2-1008H | Recombinant Human NDUFAF2, His-tagged | +Inquiry |
| NDUFAF2-1231H | Recombinant Human NDUFAF2 protein, GST-tagged | +Inquiry |
| NDUFAF2-946H | Recombinant Human NDUFAF2 | +Inquiry |
| NDUFAF2-4251C | Recombinant Chicken NDUFAF2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFAF2-436HCL | Recombinant Human NDUFAF2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFAF2 Products
Required fields are marked with *
My Review for All NDUFAF2 Products
Required fields are marked with *
