Recombinant Human NDUFAF2, His-tagged

Cat.No. : NDUFAF2-30238TH
Product Overview : Recombinant full length Human Mimitin with an N terminal His tag; 189 amino acids with tag, Predicted MWt 22 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 169 amino acids
Description : NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency.
Conjugation : HIS
Molecular Weight : 22.000kDa inclusive of tags
Tissue specificity : Highly expressed in ESCC cells. Also expressed in heart, skeletal muscle, liver, and in fibroblasts.
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
Sequence Similarities : Belongs to the complex I NDUFA12 subunit family.
Gene Name NDUFAF2 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 [ Homo sapiens ]
Official Symbol NDUFAF2
Synonyms NDUFAF2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2; NDUFA12 like , NDUFA12L; mimitin, mitochondrial; B17.2L; mimitin; MMTN; Myc induced mitochondrial protein;
Gene ID 91942
mRNA Refseq NM_174889
Protein Refseq NP_777549
MIM 609653
Uniprot ID Q8N183
Chromosome Location 5q12.1
Pathway Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function NADH dehydrogenase (ubiquinone) activity; electron carrier activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFAF2 Products

Required fields are marked with *

My Review for All NDUFAF2 Products

Required fields are marked with *

0
cart-icon