Recombinant Human NDUFAF2, His-tagged
Cat.No. : | NDUFAF2-30238TH |
Product Overview : | Recombinant full length Human Mimitin with an N terminal His tag; 189 amino acids with tag, Predicted MWt 22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 169 amino acids |
Description : | NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency. |
Conjugation : | HIS |
Molecular Weight : | 22.000kDa inclusive of tags |
Tissue specificity : | Highly expressed in ESCC cells. Also expressed in heart, skeletal muscle, liver, and in fibroblasts. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ |
Sequence Similarities : | Belongs to the complex I NDUFA12 subunit family. |
Gene Name | NDUFAF2 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 [ Homo sapiens ] |
Official Symbol | NDUFAF2 |
Synonyms | NDUFAF2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2; NDUFA12 like , NDUFA12L; mimitin, mitochondrial; B17.2L; mimitin; MMTN; Myc induced mitochondrial protein; |
Gene ID | 91942 |
mRNA Refseq | NM_174889 |
Protein Refseq | NP_777549 |
MIM | 609653 |
Uniprot ID | Q8N183 |
Chromosome Location | 5q12.1 |
Pathway | Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
Function | NADH dehydrogenase (ubiquinone) activity; electron carrier activity; |
◆ Recombinant Proteins | ||
NDUFAF2-517H | Recombinant Human NDUFAF2 Protein, MYC/DDK-tagged | +Inquiry |
NDUFAF2-1231H | Recombinant Human NDUFAF2 protein, GST-tagged | +Inquiry |
NDUFAF2-3600H | Recombinant Human NDUFAF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFAF2-2797R | Recombinant Rhesus Macaque NDUFAF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFAF2-30238TH | Recombinant Human NDUFAF2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFAF2-436HCL | Recombinant Human NDUFAF2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFAF2 Products
Required fields are marked with *
My Review for All NDUFAF2 Products
Required fields are marked with *
0
Inquiry Basket