Recombinant Human NDUFAF2 protein, GST-tagged
Cat.No. : | NDUFAF2-1231H |
Product Overview : | Recombinant Human NDUFAF2 protein(1-169 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-169 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NDUFAF2 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 [ Homo sapiens ] |
Official Symbol | NDUFAF2 |
Synonyms | NDUFAF2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2; NDUFA12 like , NDUFA12L; mimitin, mitochondrial; B17.2L; mimitin; MMTN; Myc induced mitochondrial protein; NDUFA12-like protein; Myc-induced mitochondrial protein; NDUFA12L; FLJ22398; |
Gene ID | 91942 |
mRNA Refseq | NM_174889 |
Protein Refseq | NP_777549 |
MIM | 609653 |
UniProt ID | Q8N183 |
◆ Recombinant Proteins | ||
NDUFAF2-4251C | Recombinant Chicken NDUFAF2 | +Inquiry |
NDUFAF2-1230H | Recombinant Human NDUFAF2 protein, His-tagged | +Inquiry |
NDUFAF2-1008H | Recombinant Human NDUFAF2, His-tagged | +Inquiry |
NDUFAF2-2978R | Recombinant Rhesus monkey NDUFAF2 Protein, His-tagged | +Inquiry |
NDUFAF2-3600H | Recombinant Human NDUFAF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFAF2-436HCL | Recombinant Human NDUFAF2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFAF2 Products
Required fields are marked with *
My Review for All NDUFAF2 Products
Required fields are marked with *