Recombinant Human NDUFAF2 protein, His-tagged

Cat.No. : NDUFAF2-1230H
Product Overview : Recombinant Human NDUFAF2 protein(1-169 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-169 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name NDUFAF2 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 [ Homo sapiens ]
Official Symbol NDUFAF2
Synonyms NDUFAF2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2; NDUFA12 like , NDUFA12L; mimitin, mitochondrial; B17.2L; mimitin; MMTN; Myc induced mitochondrial protein; NDUFA12-like protein; Myc-induced mitochondrial protein; NDUFA12L; FLJ22398;
Gene ID 91942
mRNA Refseq NM_174889
Protein Refseq NP_777549
MIM 609653
UniProt ID Q8N183

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFAF2 Products

Required fields are marked with *

My Review for All NDUFAF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon