Recombinant Human NDUFB11, His-tagged
Cat.No. : | NDUFB11-154H |
Product Overview : | Recombinant Human NADH Dehydrogenase [Ubiquinone] 1 β Subcomplex Subunit 11 Mitochondrial/NDUFB11 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu30-Glu153) of Human NDUFB11 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 30-153 a.a. |
Description : | NADH Dehydrogenase [Ubiquinone] 1 β Subcomplex Subunit 11 Mitochondrial (NDUFB11) belongs to the complex I NDUFB11 subunit family. NDUFB11 is a single-pass membrane protein and is a component of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
AA Sequence : | ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFG VSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDEVDHHHH HH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | NDUFB11 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa [ Homo sapiens ] |
Official Symbol | NDUFB11 |
Synonyms | NDUFB11; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; complex I NP17.3 subunit; ESSS; Np15; NP17.3; complex I-ESSS; neuronal protein 17.3; NADH-ubiquinone oxidoreductase ESSS subunit; P17.3; CI-ESSS; FLJ20494; MGC111182; |
Gene ID | 54539 |
mRNA Refseq | NM_001135998 |
Protein Refseq | NP_001129470 |
MIM | 300403 |
UniProt ID | Q9NX14 |
Chromosome Location | Xp11.3 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, organism-specific biosystem; |
◆ Cell & Tissue Lysates | ||
NDUFB11-3908HCL | Recombinant Human NDUFB11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFB11 Products
Required fields are marked with *
My Review for All NDUFB11 Products
Required fields are marked with *