Recombinant Human NDUFB11, His-tagged

Cat.No. : NDUFB11-154H
Product Overview : Recombinant Human NADH Dehydrogenase [Ubiquinone] 1 β Subcomplex Subunit 11 Mitochondrial/NDUFB11 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu30-Glu153) of Human NDUFB11 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 30-153 a.a.
Description : NADH Dehydrogenase [Ubiquinone] 1 β Subcomplex Subunit 11 Mitochondrial (NDUFB11) belongs to the complex I NDUFB11 subunit family. NDUFB11 is a single-pass membrane protein and is a component of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). Complex I catalyzes the first step in the electron transport chain, the transfer of 2 electrons from NADH to ubiquinone, coupled to the translocation of 4 protons across the membrane. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
AA Sequence : ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFG VSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDEVDHHHH HH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name NDUFB11 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa [ Homo sapiens ]
Official Symbol NDUFB11
Synonyms NDUFB11; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; complex I NP17.3 subunit; ESSS; Np15; NP17.3; complex I-ESSS; neuronal protein 17.3; NADH-ubiquinone oxidoreductase ESSS subunit; P17.3; CI-ESSS; FLJ20494; MGC111182;
Gene ID 54539
mRNA Refseq NM_001135998
Protein Refseq NP_001129470
MIM 300403
UniProt ID Q9NX14
Chromosome Location Xp11.3
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFB11 Products

Required fields are marked with *

My Review for All NDUFB11 Products

Required fields are marked with *

0
cart-icon
0
compare icon