Recombinant Human NDUFB3 protein, GST-tagged
| Cat.No. : | NDUFB3-1234H |
| Product Overview : | Recombinant Human NDUFB3 protein(1-98 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 20, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-98 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NDUFB3 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa [ Homo sapiens ] |
| Official Symbol | NDUFB3 |
| Synonyms | NDUFB3; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3 (12kD, B12); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3; B12; complex I B12 subunit; complex I-B12; NADH-ubiquinone oxidoreductase B12 subunit; CI-B12; |
| Gene ID | 4709 |
| mRNA Refseq | NM_001257102 |
| Protein Refseq | NP_001244031 |
| MIM | 603839 |
| UniProt ID | O43676 |
| ◆ Cell & Tissue Lysates | ||
| NDUFB3-3906HCL | Recombinant Human NDUFB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFB3 Products
Required fields are marked with *
My Review for All NDUFB3 Products
Required fields are marked with *
