Recombinant Human NDUFB5 Protein (94-189 aa), His-SUMO-tagged

Cat.No. : NDUFB5-681H
Product Overview : Recombinant Human NDUFB5 Protein (94-189 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 94-189 aa
Description : Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 27.5 kDa
AA Sequence : GQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name NDUFB5 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa [ Homo sapiens ]
Official Symbol NDUFB5
Synonyms NDUFB5; CI SGDH; MGC12314; SGDH; CISGDH; FLJ30597; MGC111204; DKFZp686N02262;
Gene ID 4711
mRNA Refseq NM_001199957
Protein Refseq NP_001186886
MIM 603841
UniProt ID O43674

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFB5 Products

Required fields are marked with *

My Review for All NDUFB5 Products

Required fields are marked with *

0
cart-icon