Recombinant Human NDUFB5 Protein (94-189 aa), His-SUMO-tagged

• Cat.No.: NDUFB5-681H
• Product Overview: Recombinant Human NDUFB5 Protein (94-189 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 94-189 aa
• Description: Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 27.5 kDa
• AA Sequence: GQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: NDUFB5 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa [ Homo sapiens ]
• Official Symbol: NDUFB5
• Synonyms: NDUFB5; CI SGDH; MGC12314; SGDH; CISGDH; FLJ30597; MGC111204; DKFZp686N02262
• Gene ID: 4711
• mRNA Refseq: NM_001199957
• Protein Refseq: NP_001186886
• MIM: 603841
• UniProt ID: O43674