Recombinant Human NDUFB5 Protein (94-189 aa), His-SUMO-tagged
Cat.No. : | NDUFB5-681H |
Product Overview : | Recombinant Human NDUFB5 Protein (94-189 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 94-189 aa |
Description : | Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 27.5 kDa |
AA Sequence : | GQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NDUFB5 NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa [ Homo sapiens ] |
Official Symbol | NDUFB5 |
Synonyms | NDUFB5; CI SGDH; MGC12314; SGDH; CISGDH; FLJ30597; MGC111204; DKFZp686N02262; |
Gene ID | 4711 |
mRNA Refseq | NM_001199957 |
Protein Refseq | NP_001186886 |
MIM | 603841 |
UniProt ID | O43674 |
◆ Recombinant Proteins | ||
NDUFB5-2983R | Recombinant Rhesus monkey NDUFB5 Protein, His-tagged | +Inquiry |
NDUFB5-1691C | Recombinant Chicken NDUFB5 | +Inquiry |
NDUFB5-5982M | Recombinant Mouse NDUFB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFB5-736C | Recombinant Cynomolgus NDUFB5 Protein, His-tagged | +Inquiry |
NDUFB5-2802R | Recombinant Rhesus Macaque NDUFB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFB5-3904HCL | Recombinant Human NDUFB5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFB5 Products
Required fields are marked with *
My Review for All NDUFB5 Products
Required fields are marked with *
0
Inquiry Basket