Recombinant Human NDUFS2

Cat.No. : NDUFS2-30372TH
Product Overview : Recombinant fragment Human NDUFS2 with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I). Mammalian mitochondrial complex I is composed of at least 43 different subunits, 7 of which are encoded by the mitochondrial genome, and the rest are the products of nuclear genes. The iron-sulfur protein fraction of complex I is made up of 7 subunits, including this gene product. Complex I catalyzes the NADH oxidation with concomitant ubiquinone reduction and proton ejection out of the mitochondria. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR
Sequence Similarities : Belongs to the complex I 49 kDa subunit family.
Gene Name NDUFS2 NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase) [ Homo sapiens ]
Official Symbol NDUFS2
Synonyms NDUFS2; NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe S protein 2 (49kD) (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial; CI 49; comp
Gene ID 4720
mRNA Refseq NM_001166159
Protein Refseq NP_001159631
MIM 602985
Uniprot ID O75306
Chromosome Location 1q23.3
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem;
Function 4 iron, 4 sulfur cluster binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; contributes_to NADH dehydrogenase activity; electron carrier activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFS2 Products

Required fields are marked with *

My Review for All NDUFS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon