Recombinant Human NDUFS4 protein, GST-tagged
| Cat.No. : | NDUFS4-301403H |
| Product Overview : | Recombinant Human NDUFS4 (115-175 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ala115-Lys175 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | ASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | NDUFS4 NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) [ Homo sapiens ] |
| Official Symbol | NDUFS4 |
| Synonyms | NDUFS4; NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe S protein 4 (18kD) (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial; AQDQ; CI 18; complex I 18kDa subunit; CI-AQDQ; CI-18 kDa; complex I-AQDQ; complex I-18 kDa; NADH-coenzyme Q reductase, 18-KD; NADH-ubiquinone oxidoreductase 18 kDa subunit; NADH dehydrogenase (ubiquinone) iron-sulfur protein 4; mitochondrial respiratory chain complex I (18-KD subunit); CI-18; |
| Gene ID | 4724 |
| mRNA Refseq | NM_002495 |
| Protein Refseq | NP_002486 |
| MIM | 602694 |
| UniProt ID | O43181 |
| ◆ Recombinant Proteins | ||
| NDUFS4-2509H | Recombinant Human NADH Dehydrogenase (ubiquinone) Fe-S Protein 4, 18kDa (NADH-coenzyme Q reductase) | +Inquiry |
| NDUFS4-29482TH | Recombinant Human NDUFS4 | +Inquiry |
| NDUFS4-367H | Recombinant Human NDUFS4 | +Inquiry |
| NDUFS4-1240H | Recombinant Human NDUFS4, His-tagged | +Inquiry |
| NDUFS4-2842Z | Recombinant Zebrafish NDUFS4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFS4-3895HCL | Recombinant Human NDUFS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFS4 Products
Required fields are marked with *
My Review for All NDUFS4 Products
Required fields are marked with *
