Recombinant Human NDUFS4 protein, GST-tagged

Cat.No. : NDUFS4-301403H
Product Overview : Recombinant Human NDUFS4 (115-175 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ala115-Lys175
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : ASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name NDUFS4 NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) [ Homo sapiens ]
Official Symbol NDUFS4
Synonyms NDUFS4; NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe S protein 4 (18kD) (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial; AQDQ; CI 18; complex I 18kDa subunit; CI-AQDQ; CI-18 kDa; complex I-AQDQ; complex I-18 kDa; NADH-coenzyme Q reductase, 18-KD; NADH-ubiquinone oxidoreductase 18 kDa subunit; NADH dehydrogenase (ubiquinone) iron-sulfur protein 4; mitochondrial respiratory chain complex I (18-KD subunit); CI-18;
Gene ID 4724
mRNA Refseq NM_002495
Protein Refseq NP_002486
MIM 602694
UniProt ID O43181

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NDUFS4 Products

Required fields are marked with *

My Review for All NDUFS4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon