Recombinant Human NDUFV2
Cat.No. : | NDUFV2-29481TH |
Product Overview : | Recombinant full length Human NDUFV2 with a N terminal proprietary tag; Predicted MWt 53.46 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 249 amino acids |
Description : | The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes the 24 kDa subunit of complex I, and is involved in electron transfer. Mutations in this gene are implicated in Parkinsons disease, bipolar disorder, schizophrenia, and have been found in one case of early onset hypertrophic cardiomyopathy and encephalopathy. A non-transcribed pseudogene of this locus is found on chromosome 19. |
Molecular Weight : | 53.460kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFV HRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVL PVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKV GETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKD IEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG PGFGVQAGL |
Sequence Similarities : | Belongs to the complex I 24 kDa subunit family. |
Gene Name | NDUFV2 NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa [ Homo sapiens ] |
Official Symbol | NDUFV2 |
Synonyms | NDUFV2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD); NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; CI 24k; complex I 24kDa subunit; NADH dehydrogenase [ubiquinone] flavoprot |
Gene ID | 4729 |
mRNA Refseq | NM_021074 |
Protein Refseq | NP_066552 |
MIM | 600532 |
Uniprot ID | P19404 |
Chromosome Location | 18p11.22 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; |
Function | 2 iron, 2 sulfur cluster binding; NAD binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; |
◆ Recombinant Proteins | ||
NDUFV2-3946R | Recombinant Rat NDUFV2 Protein | +Inquiry |
NDUFV2-333HF | Recombinant Full Length Human NDUFV2 Protein | +Inquiry |
NDUFV2-3604R | Recombinant Rat NDUFV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDUFV2-6595H | Recombinant Human NDUFV2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NDUFV2-2313H | Recombinant Human NDUFV2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFV2-3891HCL | Recombinant Human NDUFV2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFV2 Products
Required fields are marked with *
My Review for All NDUFV2 Products
Required fields are marked with *
0
Inquiry Basket