Recombinant Human NECTIN2 Protein, C-His-tagged
Cat.No. : | NECTIN2-237H |
Product Overview : | Recombinant Human NECTIN2 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Nectin-2, also known as CD112 and poliovirus receptor-related 2 (PVRL2), is a single-pass type I membrane glycoprotein ubiquitously expressed on various human tissues. It is a calcium independent cell adhesion molecule known to interact with several cell surface receptors, including DNAM-1 (CD226), LFA-1 (CD11a), Nectin-3 (CD113), TIGIT (VSTM3), and PVRIG (CD112R). It is one of the major constituents of adherens junctions, and therefore plays a central role in a number of cellular processes, including adhesion, migration, and proliferation. Within the immune system, Nectin-2 modulates immune cell signaling. Upon interaction with DNAM-1 expressed on T and NK cells, Nectin-2 stimulates proliferation and cytokine production. Upon interaction with PVRIG, Nectin-2 inhibits proliferation. Thus, Nectin-2 can be either a co-stimulator or a co-inhibitor of immune cell function depending on competitive receptor interactions. Nectin-2 also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Molecular Mass : | ~36 kDa |
AA Sequence : | QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | NECTIN2 nectin cell adhesion molecule 2 [ Homo sapiens (human) ] |
Official Symbol | NECTIN2 |
Synonyms | NECTIN2; nectin cell adhesion molecule 2; HVEB; PRR2; CD112; PVRL2; PVRR2; nectin-2; ; herpesvirus entry protein B; poliovirus receptor-like 2; poliovirus receptor-related 2 (herpesvirus entry mediator B) |
Gene ID | 5819 |
mRNA Refseq | NM_002856 |
Protein Refseq | NP_002847 |
MIM | 600798 |
UniProt ID | Q92692 |
◆ Recombinant Proteins | ||
NECTIN2-1179H | Recombinant Human NECTIN2 Protein (Gln32-Pro350), N-His tagged | +Inquiry |
NECTIN2-0632H | Recombinant Human NECTIN2 protein(Met1-Leu360), hFc&Avi-tagged, Biotinylated | +Inquiry |
NECTIN2-233H | Recombinant Human NECTIN2 protein, hFc-tagged | +Inquiry |
NECTIN2-7004H | Recombinant Human NECTIN2 protein, His & T7-tagged | +Inquiry |
Nectin2-249R | Recombinant Rat Nectin2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NECTIN2 Products
Required fields are marked with *
My Review for All NECTIN2 Products
Required fields are marked with *
0
Inquiry Basket