Recombinant Human NEDD4L protein, GST-tagged
Cat.No. : | NEDD4L-6744H |
Product Overview : | Recombinant Human NEDD4L protein(565-911 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 565-911 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | EESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NEDD4L neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | NEDD4L |
Synonyms | NEDD4L; neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase; neural precursor cell expressed, developmentally down regulated 4 like; E3 ubiquitin-protein ligase NEDD4-like; KIAA0439; NEDD4 2; RSP5; ubiquitin-protein ligase Rsp5; NEDD4-2; NEDD4.2; hNEDD4-2; FLJ33870; |
Gene ID | 23327 |
mRNA Refseq | NM_001144964 |
Protein Refseq | NP_001138436 |
MIM | 606384 |
UniProt ID | Q96PU5 |
◆ Recombinant Proteins | ||
NEDD4L-4142H | Recombinant Human NEDD4L Protein (Glu629-Asp975), N-His tagged | +Inquiry |
NEDD4L-6744H | Recombinant Human NEDD4L protein, GST-tagged | +Inquiry |
Nedd4l-4360M | Recombinant Mouse Nedd4l Protein, Myc/DDK-tagged | +Inquiry |
NEDD4L-0438H | Recombinant Human NEDD4L Protein (A2-D975), Tag Free | +Inquiry |
NEDD4L-0439H | Recombinant Human NEDD4L Protein (A2-D975), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEDD4L-3885HCL | Recombinant Human NEDD4L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEDD4L Products
Required fields are marked with *
My Review for All NEDD4L Products
Required fields are marked with *