Recombinant Human NEDD9 Protein, His tagged

• Cat.No.: NEDD9-001H
• Product Overview: Recombinant Human NEDD9 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 153-366 aa
• Description: The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants.
• Tag: C-His
• Molecular Mass: 25 kDa
• AA Sequence: MKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRDLVDGINHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: NEDD9 neural precursor cell expressed, developmentally down-regulated 9 [ Homo sapiens (human) ]
• Official Symbol: NEDD9
• Synonyms: NEDD9; neural precursor cell expressed, developmentally down-regulated 9; enhancer of filamentation 1; Cas scaffolding protein family member 2; CAS L; Cas like; CASS2; HEF1; p105; NEDD-9; cas-like docking; Crk-associated substrate related; renal carcinoma antigen NY-REN-12; CRK-associated substrate-related protein; dJ761I2.1 (enhancer of filamentation (HEF1)); dJ49G10.2 (Enhancer of Filamentation 1 (HEF1)); neural precursor cell expressed developmentally down-regulated protein 9; CAS2; CASL; CAS-L; dJ49G10.2; dJ761I2.1
• Gene ID: 4739
• mRNA Refseq: NM_001142393
• Protein Refseq: NP_001135865
• MIM: 602265
• UniProt ID: Q14511