Recombinant Human NELL1
| Cat.No. : | NELL1-29226TH |
| Product Overview : | Recombinant fragment of Human NELL1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF)-like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Two transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE |
| Sequence Similarities : | Contains 6 EGF-like domains.Contains 1 TSP N-terminal (TSPN) domain.Contains 5 VWFC domains. |
| Gene Name | NELL1 NEL-like 1 (chicken) [ Homo sapiens ] |
| Official Symbol | NELL1 |
| Synonyms | NELL1; NEL-like 1 (chicken); nel (chicken) like 1; protein kinase C-binding protein NELL1; FLJ45906; IDH3GL; |
| Gene ID | 4745 |
| mRNA Refseq | NM_006157 |
| Protein Refseq | NP_006148 |
| MIM | 602319 |
| Uniprot ID | Q92832 |
| Chromosome Location | 11p15.1 |
| Function | calcium ion binding; protein kinase C binding; structural molecule activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NELL1 Products
Required fields are marked with *
My Review for All NELL1 Products
Required fields are marked with *
