Recombinant Human NELL1

• Cat.No.: NELL1-29226TH
• Product Overview: Recombinant fragment of Human NELL1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF)-like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
• Sequence Similarities: Contains 6 EGF-like domains.Contains 1 TSP N-terminal (TSPN) domain.Contains 5 VWFC domains.

Gene Information

• Gene Name: NELL1 NEL-like 1 (chicken) [ Homo sapiens ]
• Official Symbol: NELL1
• Synonyms: NELL1; NEL-like 1 (chicken); nel (chicken) like 1; protein kinase C-binding protein NELL1; FLJ45906; IDH3GL
• Gene ID: 4745
• mRNA Refseq: NM_006157
• Protein Refseq: NP_006148
• MIM: 602319
• Uniprot ID: Q92832
• Chromosome Location: 11p15.1
• Function: calcium ion binding; protein kinase C binding; structural molecule activity