Recombinant Human NELL1

Cat.No. : NELL1-29226TH
Product Overview : Recombinant fragment of Human NELL1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF)-like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
Sequence Similarities : Contains 6 EGF-like domains.Contains 1 TSP N-terminal (TSPN) domain.Contains 5 VWFC domains.
Gene Name NELL1 NEL-like 1 (chicken) [ Homo sapiens ]
Official Symbol NELL1
Synonyms NELL1; NEL-like 1 (chicken); nel (chicken) like 1; protein kinase C-binding protein NELL1; FLJ45906; IDH3GL;
Gene ID 4745
mRNA Refseq NM_006157
Protein Refseq NP_006148
MIM 602319
Uniprot ID Q92832
Chromosome Location 11p15.1
Function calcium ion binding; protein kinase C binding; structural molecule activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NELL1 Products

Required fields are marked with *

My Review for All NELL1 Products

Required fields are marked with *

0
cart-icon