Recombinant Human NELL1
Cat.No. : | NELL1-29226TH |
Product Overview : | Recombinant fragment of Human NELL1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a cytoplasmic protein that contains epidermal growth factor (EGF)-like repeats. The encoded heterotrimeric protein may be involved in cell growth regulation and differentiation. A similar protein in rodents is involved in craniosynostosis. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE |
Sequence Similarities : | Contains 6 EGF-like domains.Contains 1 TSP N-terminal (TSPN) domain.Contains 5 VWFC domains. |
Gene Name | NELL1 NEL-like 1 (chicken) [ Homo sapiens ] |
Official Symbol | NELL1 |
Synonyms | NELL1; NEL-like 1 (chicken); nel (chicken) like 1; protein kinase C-binding protein NELL1; FLJ45906; IDH3GL; |
Gene ID | 4745 |
mRNA Refseq | NM_006157 |
Protein Refseq | NP_006148 |
MIM | 602319 |
Uniprot ID | Q92832 |
Chromosome Location | 11p15.1 |
Function | calcium ion binding; protein kinase C binding; structural molecule activity; |
◆ Recombinant Proteins | ||
NELL1-01H | Active Recombinant Human NELL1 Protein, His-tagged | +Inquiry |
NELL1-29225TH | Recombinant Human NELL1 | +Inquiry |
NELL1-336HF | Recombinant Full Length Human NELL1 Protein | +Inquiry |
NELL1-10581M | Recombinant Mouse NELL1 Protein | +Inquiry |
NELL1-6013M | Recombinant Mouse NELL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NELL1-1185HCL | Recombinant Human NELL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NELL1 Products
Required fields are marked with *
My Review for All NELL1 Products
Required fields are marked with *