Recombinant Human NEU2

• Cat.No.: NEU2-29303TH
• Product Overview: Recombinant fragment of Human NEU2 with an N terminal proprietary tag; Predicted MWt 35.42 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 89 amino acids
• Description: This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments.
• Molecular Weight: 35.420kDa inclusive of tags
• Tissue specificity: Expressed in skeletal muscle, fetal liver and embryonic carcinoma cell line NT2D1.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
• Sequence Similarities: Belongs to the glycosyl hydrolase 33 family.Contains 2 BNR repeats.

Gene Information

• Gene Name: NEU2 sialidase 2 (cytosolic sialidase) [ Homo sapiens ]
• Official Symbol: NEU2
• Synonyms: NEU2; sialidase 2 (cytosolic sialidase); sialidase-2; N acetyl alpha neuraminidase 2; SIAL2
• Gene ID: 4759
• mRNA Refseq: NM_005383
• Protein Refseq: NP_005374
• MIM: 605528
• Uniprot ID: Q9Y3R4
• Chromosome Location: 2q37
• Pathway: Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem
• Function: catalytic activity; exo-alpha-(2->3)-sialidase activity; exo-alpha-(2->6)-sialidase activity