Recombinant Human NEU2
| Cat.No. : | NEU2-29303TH |
| Product Overview : | Recombinant fragment of Human NEU2 with an N terminal proprietary tag; Predicted MWt 35.42 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 89 amino acids |
| Description : | This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. |
| Molecular Weight : | 35.420kDa inclusive of tags |
| Tissue specificity : | Expressed in skeletal muscle, fetal liver and embryonic carcinoma cell line NT2D1. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP |
| Sequence Similarities : | Belongs to the glycosyl hydrolase 33 family.Contains 2 BNR repeats. |
| Gene Name | NEU2 sialidase 2 (cytosolic sialidase) [ Homo sapiens ] |
| Official Symbol | NEU2 |
| Synonyms | NEU2; sialidase 2 (cytosolic sialidase); sialidase-2; N acetyl alpha neuraminidase 2; SIAL2; |
| Gene ID | 4759 |
| mRNA Refseq | NM_005383 |
| Protein Refseq | NP_005374 |
| MIM | 605528 |
| Uniprot ID | Q9Y3R4 |
| Chromosome Location | 2q37 |
| Pathway | Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem; |
| Function | catalytic activity; exo-alpha-(2->3)-sialidase activity; exo-alpha-(2->6)-sialidase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU2 Products
Required fields are marked with *
My Review for All NEU2 Products
Required fields are marked with *
