Recombinant Human NEU2
Cat.No. : | NEU2-29303TH |
Product Overview : | Recombinant fragment of Human NEU2 with an N terminal proprietary tag; Predicted MWt 35.42 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Description : | This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. |
Molecular Weight : | 35.420kDa inclusive of tags |
Tissue specificity : | Expressed in skeletal muscle, fetal liver and embryonic carcinoma cell line NT2D1. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP |
Sequence Similarities : | Belongs to the glycosyl hydrolase 33 family.Contains 2 BNR repeats. |
Gene Name | NEU2 sialidase 2 (cytosolic sialidase) [ Homo sapiens ] |
Official Symbol | NEU2 |
Synonyms | NEU2; sialidase 2 (cytosolic sialidase); sialidase-2; N acetyl alpha neuraminidase 2; SIAL2; |
Gene ID | 4759 |
mRNA Refseq | NM_005383 |
Protein Refseq | NP_005374 |
MIM | 605528 |
Uniprot ID | Q9Y3R4 |
Chromosome Location | 2q37 |
Pathway | Other glycan degradation, organism-specific biosystem; Other glycan degradation, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem; |
Function | catalytic activity; exo-alpha-(2->3)-sialidase activity; exo-alpha-(2->6)-sialidase activity; |
◆ Recombinant Proteins | ||
NEU2-754H | Recombinant Human NEU2 Protein, His-tagged | +Inquiry |
NEU2-729H | Recombinant Human NEU2 Protein, His-tagged | +Inquiry |
NEU2-29303TH | Recombinant Human NEU2 | +Inquiry |
NEU2-2317C | Recombinant Chinese hamster NEU2 protein, His&Myc-tagged | +Inquiry |
Neu2-1189R | Recombinant Rat Neu2 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU2-3870HCL | Recombinant Human NEU2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEU2 Products
Required fields are marked with *
My Review for All NEU2 Products
Required fields are marked with *
0
Inquiry Basket