Recombinant Human NEU3 protein, GST-tagged

Cat.No. : NEU3-301462H
Product Overview : Recombinant Human NEU3 (193-326 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met193-Glu326
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSE
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name NEU3 sialidase 3 (membrane sialidase) [ Homo sapiens ]
Official Symbol NEU3
Synonyms NEU3; sialidase 3 (membrane sialidase); sialidase-3; neuraminidase 3; membrane sialidase; ganglioside sialidase; N-acetyl-alpha-neuraminidase 3; SIAL3; FLJ12388;
Gene ID 10825
mRNA Refseq NM_006656
Protein Refseq NP_006647
MIM 604617
UniProt ID Q9UQ49

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NEU3 Products

Required fields are marked with *

My Review for All NEU3 Products

Required fields are marked with *

0
cart-icon