Recombinant Human NEU3 protein, GST-tagged
| Cat.No. : | NEU3-301462H |
| Product Overview : | Recombinant Human NEU3 (193-326 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met193-Glu326 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | NEU3 sialidase 3 (membrane sialidase) [ Homo sapiens ] |
| Official Symbol | NEU3 |
| Synonyms | NEU3; sialidase 3 (membrane sialidase); sialidase-3; neuraminidase 3; membrane sialidase; ganglioside sialidase; N-acetyl-alpha-neuraminidase 3; SIAL3; FLJ12388; |
| Gene ID | 10825 |
| mRNA Refseq | NM_006656 |
| Protein Refseq | NP_006647 |
| MIM | 604617 |
| UniProt ID | Q9UQ49 |
| ◆ Recombinant Proteins | ||
| NEU3-4949H | Recombinant Human NEU3 protein, His-tagged | +Inquiry |
| NEU3-3932H | Recombinant Human NEU3 Protein (Met1-Asn428), C-His tagged | +Inquiry |
| NEU3-4603H | Recombinant Human NEU3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NEU3-708H | Recombinant Human NEU3 | +Inquiry |
| NEU3-301462H | Recombinant Human NEU3 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU3 Products
Required fields are marked with *
My Review for All NEU3 Products
Required fields are marked with *
