Recombinant Human NEUROD1 protein, T7/His-tagged
Cat.No. : | NEUROD1-224H |
Product Overview : | Recombinant human NeuroD1 (355aa) fused with T7-His-TEV cleavage site Tag at N-terminal and 11 arginine (11R tag) at its C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | 29aa_Tag_TKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDEDLE EEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIET LRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVH PYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAE FEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHDLEESGGGGSPG RRRRRRRRRRR |
Purity : | >90% by SDS-PAGE. |
Applications : | 1. May be used for in vitro NeuroD1 mediated gene transcription regulation study for neuronal cell differentiation by intracellular delivery of this protein2. May be used for mapping NeuroD1 protein-protein interaction.3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As Immunogen for specific antibody development. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | NEUROD1 neuronal differentiation 1 [ Homo sapiens ] |
Official Symbol | NEUROD1 |
Synonyms | NEUROD1; neuronal differentiation 1; NEUROD, neurogenic differentiation 1; beta cell E box transactivator 2; BETA2; BHF 1; bHLHa3; MODY6; NeuroD;BHF-1; NEUROD; |
Gene ID | 4760 |
mRNA Refseq | NM_002500 |
Protein Refseq | NP_002491 |
MIM | 601724 |
UniProt ID | Q13562 |
Chromosome Location | 2q32 |
Pathway | Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in beta cells, organism-specific biosystem; Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells, organism-specific biosystem; |
Function | E-box binding; RNA polymerase II activating transcription factor binding; RNA polymerase II transcription coactivator activity; chromatin binding; double-stranded DNA binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; contributes_to sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
NEUROD1-555H | Recombinant Human NEUROD1 | +Inquiry |
NEUROD1-6482C | Recombinant Chicken NEUROD1 | +Inquiry |
NEUROD1-1268H | Recombinant Human NEUROD1, GST-tagged | +Inquiry |
NEUROD1-389HFL | Recombinant Full Length Human NEUROD1 Protein, C-Flag-tagged | +Inquiry |
NEUROD1-3217H | Recombinant Human NEUROD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEUROD1-3868HCL | Recombinant Human NEUROD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEUROD1 Products
Required fields are marked with *
My Review for All NEUROD1 Products
Required fields are marked with *