"NEUROD1" Related Products

Expand
Expand

Recombinant Human NEUROD1 protein, T7/His-tagged

Cat.No.: NEUROD1-224H
Product Overview: Recombinant human NeuroD1 (355aa) fused with T7-His-TEV cleavage site Tag at N-terminal and 11 arginine (11R tag) at its C-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: 29aa_Tag_TKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDEDLE EEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIET LRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVH PYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAE FEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHDLEESGGGGSPG RRRRRRRRRRR
Purity: >90% by SDS-PAGE.
Applications: 1. May be used for in vitro NeuroD1 mediated gene transcription regulation study for neuronal cell differentiation by intracellular delivery of this protein2. May be used for mapping NeuroD1 protein-protein interaction.3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As Immunogen for specific antibody development.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: NEUROD1 neuronal differentiation 1 [ Homo sapiens ]
Official Symbol: NEUROD1
Synonyms: NEUROD1; neuronal differentiation 1; NEUROD, neurogenic differentiation 1; beta cell E box transactivator 2; BETA2; BHF 1; bHLHa3; MODY6; NeuroD;BHF-1; NEUROD;
Gene ID: 4760
mRNA Refseq: NM_002500
Protein Refseq: NP_002491
MIM: 601724
UniProt ID: Q13562
Chromosome Location: 2q32
Pathway: Developmental Biology, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Regulation of beta-cell development, organism-specific biosystem; Regulation of gene expression in beta cells, organism-specific biosystem; Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells, organism-specific biosystem;
Function: E-box binding; RNA polymerase II activating transcription factor binding; RNA polymerase II transcription coactivator activity; chromatin binding; double-stranded DNA binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; contributes_to sequence-specific DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.