Recombinant Human NFASC protein(1241-1330 aa), C-His-tagged
Cat.No. : | NFASC-2489H |
Product Overview : | Recombinant Human NFASC protein(O94856)(1241-1330 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1241-1330 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEG |
Gene Name | NFASC neurofascin [ Homo sapiens ] |
Official Symbol | NFASC |
Synonyms | NFASC; neurofascin; neurofascin homolog (chicken); FLJ46866; KIAA0756; NF; NRCAML; neurofascin homolog; DKFZp686P2250; |
Gene ID | 23114 |
mRNA Refseq | NM_001005388 |
Protein Refseq | NP_001005388 |
MIM | 609145 |
UniProt ID | O94856 |
◆ Recombinant Proteins | ||
NFASC-501H | Recombinant Human NFASC protein, hFc-tagged, Biotinylated | +Inquiry |
NFASC-1234C | Recombinant Chicken NFASC | +Inquiry |
NFASC-689H | Active Recombinant Human NFASC Protein, His-tagged | +Inquiry |
NFASC-3627R | Recombinant Rat NFASC Protein, His (Fc)-Avi-tagged | +Inquiry |
NFASC-2687H | Recombinant Human NFASC protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFASC-918HCL | Recombinant Human NFASC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFASC Products
Required fields are marked with *
My Review for All NFASC Products
Required fields are marked with *