Recombinant Human NFASC protein(1241-1330 aa), C-His-tagged
| Cat.No. : | NFASC-2489H |
| Product Overview : | Recombinant Human NFASC protein(O94856)(1241-1330 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1241-1330 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEG |
| Gene Name | NFASC neurofascin [ Homo sapiens ] |
| Official Symbol | NFASC |
| Synonyms | NFASC; neurofascin; neurofascin homolog (chicken); FLJ46866; KIAA0756; NF; NRCAML; neurofascin homolog; DKFZp686P2250; |
| Gene ID | 23114 |
| mRNA Refseq | NM_001005388 |
| Protein Refseq | NP_001005388 |
| MIM | 609145 |
| UniProt ID | O94856 |
| ◆ Recombinant Proteins | ||
| NFASC-596H | Recombinant Human NFASC Protein, GST-tagged | +Inquiry |
| NFASC-3627R | Recombinant Rat NFASC Protein, His (Fc)-Avi-tagged | +Inquiry |
| NFASC-1349H | Recombinant Human NFASC protein(Met1-Gln939), hFc-tagged | +Inquiry |
| Nfasc-14R | Active Recombinant Rat Neurofascin | +Inquiry |
| NFASC-12H | Recombinant Human NFASC Protein, C-Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFASC-918HCL | Recombinant Human NFASC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFASC Products
Required fields are marked with *
My Review for All NFASC Products
Required fields are marked with *
