Recombinant Human NFATC3
Cat.No. : | NFATC3-29252TH |
Product Overview : | Recombinant fragment corresponding to amino acids 70-149 of Human NFAT4 with an N terminal proprietary tag; Predicted MWt 34.43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 80 amino acids |
Description : | The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene. |
Molecular Weight : | 34.430kDa inclusive of tags |
Tissue specificity : | Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, hear |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL |
Sequence Similarities : | Contains 1 RHD (Rel-like) domain. |
Gene Name | NFATC3 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 [ Homo sapiens ] |
Official Symbol | NFATC3 |
Synonyms | NFATC3; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3; nuclear factor of activated T-cells, cytoplasmic 3; NFAT4; NFATX; |
Gene ID | 4775 |
mRNA Refseq | NM_004555 |
Protein Refseq | NP_004546 |
MIM | 602698 |
Uniprot ID | Q12968 |
Chromosome Location | 16q22 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; |
Function | DNA binding; chromatin binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
NFATC3-236H | Recombinant Human NFATC3 Protein, MYC/DDK-tagged | +Inquiry |
NFATC3-339HF | Recombinant Full Length Human NFATC3 Protein | +Inquiry |
NFATC3-29252TH | Recombinant Human NFATC3 | +Inquiry |
Nfatc3-4389M | Recombinant Mouse Nfatc3 Protein, Myc/DDK-tagged | +Inquiry |
NFATC3-27538TH | Recombinant Human NFATC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFATC3-3856HCL | Recombinant Human NFATC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFATC3 Products
Required fields are marked with *
My Review for All NFATC3 Products
Required fields are marked with *
0
Inquiry Basket