Recombinant Human NFIL3 protein, T7/His-tagged
| Cat.No. : | NFIL3-150H |
| Product Overview : | Recombinant human NFIL3 cDNA (461 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEEL LLSEGSVGKNKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSS VEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGNSFSGYSHSPPLLQVNRSSSN SPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEF EATQKLSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | NFIL3 nuclear factor, interleukin 3 regulated [ Homo sapiens ] |
| Official Symbol | NFIL3 |
| Synonyms | NFIL3; nuclear factor, interleukin 3 regulated; IL3BP1; nuclear factor interleukin-3-regulated protein; E4BP4; NF IL3A; NFIL3A; E4 promoter-binding protein 4; interleukin-3-binding protein 1; transcriptional activator NF-IL3A; nuclear factor interleukin 3 regulated protein; interleukin-3 promoter transcriptional activator; NF-IL3A; |
| Gene ID | 4783 |
| mRNA Refseq | NM_005384 |
| Protein Refseq | NP_005375 |
| MIM | 605327 |
| UniProt ID | Q16649 |
| Chromosome Location | 9q22 |
| Function | DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II regulatory region sequence-specific DNA binding; protein dimerizat |
| ◆ Recombinant Proteins | ||
| NFIL3-3633R | Recombinant Rat NFIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NFIL3-3974R | Recombinant Rat NFIL3 Protein | +Inquiry |
| NFIL3-2833R | Recombinant Rhesus Macaque NFIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NFIL3-6186C | Recombinant Chicken NFIL3 | +Inquiry |
| NFIL3-10620M | Recombinant Mouse NFIL3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFIL3-1189HCL | Recombinant Human NFIL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFIL3 Products
Required fields are marked with *
My Review for All NFIL3 Products
Required fields are marked with *



