Recombinant Human NFIX

Cat.No. : NFIX-30379TH
Product Overview : Recombinant fragment of Human NFIX with an N terminal proprietary tag; Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Nuclear factor 1 X-type is a protein that in humans is encoded by the NFIX gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR
Sequence Similarities : Belongs to the CTF/NF-I family.Contains 1 CTF/NF-I DNA-binding domain.
Gene Name NFIX nuclear factor I/X (CCAAT-binding transcription factor) [ Homo sapiens ]
Official Symbol NFIX
Synonyms NFIX; nuclear factor I/X (CCAAT-binding transcription factor); nuclear factor 1 X-type; NF1A;
Gene ID 4784
mRNA Refseq NM_002501
Protein Refseq NP_002492
MIM 164005
Uniprot ID Q14938
Chromosome Location 19p13.3
Pathway Oxidative Stress, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; RNA Polymerase III Abortive And Retractive Initiation, organism-specific biosystem; RNA Polymerase III Transcription, organism-specific biosystem; RNA Polymerase III Transcription Termination, organism-specific biosystem;
Function DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFIX Products

Required fields are marked with *

My Review for All NFIX Products

Required fields are marked with *

0
cart-icon