Recombinant Human NFIX
Cat.No. : | NFIX-30379TH |
Product Overview : | Recombinant fragment of Human NFIX with an N terminal proprietary tag; Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Nuclear factor 1 X-type is a protein that in humans is encoded by the NFIX gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR |
Sequence Similarities : | Belongs to the CTF/NF-I family.Contains 1 CTF/NF-I DNA-binding domain. |
Gene Name | NFIX nuclear factor I/X (CCAAT-binding transcription factor) [ Homo sapiens ] |
Official Symbol | NFIX |
Synonyms | NFIX; nuclear factor I/X (CCAAT-binding transcription factor); nuclear factor 1 X-type; NF1A; |
Gene ID | 4784 |
mRNA Refseq | NM_002501 |
Protein Refseq | NP_002492 |
MIM | 164005 |
Uniprot ID | Q14938 |
Chromosome Location | 19p13.3 |
Pathway | Oxidative Stress, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; RNA Polymerase III Abortive And Retractive Initiation, organism-specific biosystem; RNA Polymerase III Transcription, organism-specific biosystem; RNA Polymerase III Transcription Termination, organism-specific biosystem; |
Function | DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
◆ Recombinant Proteins | ||
Nfix-4847M | Recombinant Mouse Nfix protein | +Inquiry |
Nfix-4848M | Recombinant Mouse Nfix protein | +Inquiry |
NFIX-30379TH | Recombinant Human NFIX | +Inquiry |
Nfix-4846M | Recombinant Mouse Nfix protein, Avi-tagged, Biotinylated | +Inquiry |
Nfix-4845M | Recombinant Mouse Nfix protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFIX-1190HCL | Recombinant Human NFIX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFIX Products
Required fields are marked with *
My Review for All NFIX Products
Required fields are marked with *
0
Inquiry Basket