Recombinant Human NFIX
| Cat.No. : | NFIX-30379TH |
| Product Overview : | Recombinant fragment of Human NFIX with an N terminal proprietary tag; Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | Nuclear factor 1 X-type is a protein that in humans is encoded by the NFIX gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR |
| Sequence Similarities : | Belongs to the CTF/NF-I family.Contains 1 CTF/NF-I DNA-binding domain. |
| Gene Name | NFIX nuclear factor I/X (CCAAT-binding transcription factor) [ Homo sapiens ] |
| Official Symbol | NFIX |
| Synonyms | NFIX; nuclear factor I/X (CCAAT-binding transcription factor); nuclear factor 1 X-type; NF1A; |
| Gene ID | 4784 |
| mRNA Refseq | NM_002501 |
| Protein Refseq | NP_002492 |
| MIM | 164005 |
| Uniprot ID | Q14938 |
| Chromosome Location | 19p13.3 |
| Pathway | Oxidative Stress, organism-specific biosystem; RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription, organism-specific biosystem; RNA Polymerase III Abortive And Retractive Initiation, organism-specific biosystem; RNA Polymerase III Transcription, organism-specific biosystem; RNA Polymerase III Transcription Termination, organism-specific biosystem; |
| Function | DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; |
| ◆ Recombinant Proteins | ||
| Nfix-4848M | Recombinant Mouse Nfix protein | +Inquiry |
| Nfix-4846M | Recombinant Mouse Nfix protein, Avi-tagged, Biotinylated | +Inquiry |
| NFIX-6822C | Recombinant Chicken NFIX | +Inquiry |
| Nfix-4847M | Recombinant Mouse Nfix protein | +Inquiry |
| Nfix-4845M | Recombinant Mouse Nfix protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFIX-1190HCL | Recombinant Human NFIX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFIX Products
Required fields are marked with *
My Review for All NFIX Products
Required fields are marked with *



